Gene/Proteome Database (LMPD)
LMPD ID
LMP012980
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
myo-inositol oxygenase
Gene Symbol
Synonyms
RSOR; Aldrl6;
Alternate Names
inositol oxygenase; MI oxygenase; aldehyde reductase-like 6; kidney-specific protein 32; renal-specific oxidoreductase; renal-specific oxido-reductase; aldehyde reductase (aldose reductase) like 6;
Chromosome
7
Map Location
7q34
EC Number
1.13.99.1
Summary
may play a role in diabetic renal complications [RGD, Feb 2006]
Orthologs
Proteins
inositol oxygenase | |
---|---|
Refseq ID | NP_665714 |
Protein GI | 56090638 |
UniProt ID | Q9QXN4 |
mRNA ID | NM_145771 |
Length | 285 |
MKVDLGPDPSLVYRPDVDPEMAKSKGSFRNYTSGPLLDRVFTTYKLMHTHQTVDFVMRKRIQFGSFSYKKMTVMEAVDMLDDLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKILALWGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLENVLMSWGHDEYLYQMMKFNKFSLPSEAFYMVRFHSFYPWHTGGDYRQLCSQQDLDMLPWVQEFNKFDLYTKCPDLPEVKSLRPYYQGLIDKYCPGILSW |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005737 | ISS:UniProtKB | C | cytoplasm |
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0016234 | ISS:UniProtKB | C | inclusion body |
GO:0050661 | IDA:RGD | F | NADP binding |
GO:0004033 | ISS:UniProtKB | F | aldo-keto reductase (NADP) activity |
GO:0008199 | ISS:UniProtKB | F | ferric iron binding |
GO:0050113 | ISS:UniProtKB | F | inositol oxygenase activity |
GO:0016651 | IEA:Ensembl | F | oxidoreductase activity, acting on NAD(P)H |
GO:0016701 | ISS:UniProtKB | F | oxidoreductase activity, acting on single donors with incorporation of molecular oxygen |
GO:0019310 | ISS:UniProtKB | P | inositol catabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Myo-inositol + O(2) = D-glucuronate + H(2)O. |
Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence= ; Note=Binds 2 iron ions per subunit. ; |
Pathway | Polyol metabolism; myo-inositol degradation into D- glucuronate; D-glucuronate from myo-inositol: step 1/1. |
Similarity | Belongs to the myo-inositol oxygenase family |
Subcellular Location | Cytoplasm . |
Tissue Specificity | Kidney specific. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012980 (as displayed in Record Overview)
Identical Sequences to LMP012980 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:56090638 | GenBank | AAH78840.1 | 285 | Myo-inositol oxygenase [Rattus norvegicus] |
GI:56090638 | GenBank | EDL76557.1 | 285 | myo-inositol oxygenase, isoform CRA_a [Rattus norvegicus] |
GI:56090638 | SwissProt | Q9QXN4.2 | 285 | RecName: Full=Inositol oxygenase; AltName: Full=Aldehyde reductase-like 6; AltName: Full=Kidney-specific protein 32; AltName: Full=Myo-inositol oxygenase; Short=MI oxygenase; AltName: Full=Renal-specific oxidoreductase [Rattus norvegicus] |
Related Sequences to LMP012980 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:56090638 | GenBank | AAH78840.1 | 285 | Myo-inositol oxygenase [Rattus norvegicus] |
GI:56090638 | GenBank | EDL76557.1 | 285 | myo-inositol oxygenase, isoform CRA_a [Rattus norvegicus] |
GI:56090638 | GenBank | ADS97250.1 | 285 | Sequence 13 from patent US 7829760 |
GI:56090638 | SwissProt | Q9QXN4.2 | 285 | RecName: Full=Inositol oxygenase; AltName: Full=Aldehyde reductase-like 6; AltName: Full=Kidney-specific protein 32; AltName: Full=Myo-inositol oxygenase; Short=MI oxygenase; AltName: Full=Renal-specific oxidoreductase [Rattus norvegicus] |