Gene/Proteome Database (LMPD)

LMPD ID
LMP012980
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
myo-inositol oxygenase
Gene Symbol
Synonyms
RSOR; Aldrl6;
Alternate Names
inositol oxygenase; MI oxygenase; aldehyde reductase-like 6; kidney-specific protein 32; renal-specific oxidoreductase; renal-specific oxido-reductase; aldehyde reductase (aldose reductase) like 6;
Chromosome
7
Map Location
7q34
EC Number
1.13.99.1
Summary
may play a role in diabetic renal complications [RGD, Feb 2006]
Orthologs

Proteins

inositol oxygenase
Refseq ID NP_665714
Protein GI 56090638
UniProt ID Q9QXN4
mRNA ID NM_145771
Length 285
MKVDLGPDPSLVYRPDVDPEMAKSKGSFRNYTSGPLLDRVFTTYKLMHTHQTVDFVMRKRIQFGSFSYKKMTVMEAVDMLDDLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKILALWGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLENVLMSWGHDEYLYQMMKFNKFSLPSEAFYMVRFHSFYPWHTGGDYRQLCSQQDLDMLPWVQEFNKFDLYTKCPDLPEVKSLRPYYQGLIDKYCPGILSW

Gene Information

Entrez Gene ID
Gene Name
myo-inositol oxygenase
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 ISS:UniProtKB C cytoplasm
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0016234 ISS:UniProtKB C inclusion body
GO:0050661 IDA:RGD F NADP binding
GO:0004033 ISS:UniProtKB F aldo-keto reductase (NADP) activity
GO:0008199 ISS:UniProtKB F ferric iron binding
GO:0050113 ISS:UniProtKB F inositol oxygenase activity
GO:0016651 IEA:Ensembl F oxidoreductase activity, acting on NAD(P)H
GO:0016701 ISS:UniProtKB F oxidoreductase activity, acting on single donors with incorporation of molecular oxygen
GO:0019310 ISS:UniProtKB P inositol catabolic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00053 Ascorbate and aldarate metabolism
rno00053 Ascorbate and aldarate metabolism
ko00562 Inositol phosphate metabolism
rno00562 Inositol phosphate metabolism

Domain Information

InterPro Annotations

Accession Description
IPR018170 Aldo/keto reductase, conserved site
IPR007828 Inositol_oxygenase

UniProt Annotations

Entry Information

Gene Name
myo-inositol oxygenase
Protein Entry
MIOX_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity Myo-inositol + O(2) = D-glucuronate + H(2)O.
Cofactor Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence= ; Note=Binds 2 iron ions per subunit. ;
Pathway Polyol metabolism; myo-inositol degradation into D- glucuronate; D-glucuronate from myo-inositol: step 1/1.
Similarity Belongs to the myo-inositol oxygenase family
Subcellular Location Cytoplasm .
Tissue Specificity Kidney specific.

Identical and Related Proteins

Unique RefSeq proteins for LMP012980 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
56090638 RefSeq NP_665714 285 inositol oxygenase

Identical Sequences to LMP012980 proteins

Reference Database Accession Length Protein Name
GI:56090638 GenBank AAH78840.1 285 Myo-inositol oxygenase [Rattus norvegicus]
GI:56090638 GenBank EDL76557.1 285 myo-inositol oxygenase, isoform CRA_a [Rattus norvegicus]
GI:56090638 SwissProt Q9QXN4.2 285 RecName: Full=Inositol oxygenase; AltName: Full=Aldehyde reductase-like 6; AltName: Full=Kidney-specific protein 32; AltName: Full=Myo-inositol oxygenase; Short=MI oxygenase; AltName: Full=Renal-specific oxidoreductase [Rattus norvegicus]

Related Sequences to LMP012980 proteins

Reference Database Accession Length Protein Name
GI:56090638 GenBank AAH78840.1 285 Myo-inositol oxygenase [Rattus norvegicus]
GI:56090638 GenBank EDL76557.1 285 myo-inositol oxygenase, isoform CRA_a [Rattus norvegicus]
GI:56090638 GenBank ADS97250.1 285 Sequence 13 from patent US 7829760
GI:56090638 SwissProt Q9QXN4.2 285 RecName: Full=Inositol oxygenase; AltName: Full=Aldehyde reductase-like 6; AltName: Full=Kidney-specific protein 32; AltName: Full=Myo-inositol oxygenase; Short=MI oxygenase; AltName: Full=Renal-specific oxidoreductase [Rattus norvegicus]