Gene/Proteome Database (LMPD)
LMPD ID
LMP012981
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
diacylglycerol O-acyltransferase 2
Gene Symbol
Synonyms
ARAT;
Alternate Names
diacylglycerol O-acyltransferase 2; diglyceride acyltransferase 2; retinol O-fatty-acyltransferase; acyl-CoA retinol O-fatty-acyltransferase;
Chromosome
1
Map Location
1q32
EC Number
2.3.1.20
Summary
catalyzes a reaction in which diacylglycerol is covalently joined to long chain fatty acyl-CoAs [RGD, Feb 2006]
Orthologs
Proteins
| diacylglycerol O-acyltransferase 2 | |
|---|---|
| Refseq ID | NP_001012345 |
| Protein GI | 59891415 |
| UniProt ID | Q5FVP8 |
| mRNA ID | NM_001012345 |
| Length | 388 |
| MKTLIAAYSGVLRGERRAEAARSENKNKGSALSREGSGRWGTGSSILSALQDIFSVTWLNRSKVEKHLQVISVLQWVLSFLVLGVACSVILMYTFCTDCWLIAALYFTWLAFDWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVNRDTIDYLLSKNGSGNAIVIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPTYSFGENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITVPKLEHPTQKDIDLYHTMYMEALVKLFDNHKTKFGLPETEVLEVN | |
Gene Information
Entrez Gene ID
Gene Name
diacylglycerol O-acyltransferase 2
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0030176 | IEA:Ensembl | C | integral component of endoplasmic reticulum membrane |
| GO:0043231 | IDA:RGD | C | intracellular membrane-bounded organelle |
| GO:0005811 | IEA:UniProtKB-KW | C | lipid particle |
| GO:0005739 | IEA:Ensembl | C | mitochondrion |
| GO:0048471 | IEA:Ensembl | C | perinuclear region of cytoplasm |
| GO:0003846 | IEA:Ensembl | F | 2-acylglycerol O-acyltransferase activity |
| GO:0004144 | IDA:RGD | F | diacylglycerol O-acyltransferase activity |
| GO:0050252 | IEA:UniProtKB-EC | F | retinol O-fatty-acyltransferase activity |
| GO:0071400 | IEA:Ensembl | P | cellular response to oleic acid |
| GO:0035356 | IEA:Ensembl | P | cellular triglyceride homeostasis |
| GO:0042632 | IEA:Ensembl | P | cholesterol homeostasis |
| GO:0046339 | IEA:Ensembl | P | diacylglycerol metabolic process |
| GO:0060613 | IEA:Ensembl | P | fat pad development |
| GO:0055089 | IEA:Ensembl | P | fatty acid homeostasis |
| GO:0006071 | IEA:UniProtKB-KW | P | glycerol metabolic process |
| GO:0019915 | IEA:Ensembl | P | lipid storage |
| GO:0035336 | IEA:Ensembl | P | long-chain fatty-acyl-CoA metabolic process |
| GO:0034383 | IEA:Ensembl | P | low-density lipoprotein particle clearance |
| GO:0019432 | IEA:UniProtKB-UniPathway | P | triglyceride biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko04975 | Fat digestion and absorption |
| rno04975 | Fat digestion and absorption |
| ko00561 | Glycerolipid metabolism |
| rno00561 | Glycerolipid metabolism |
| rno01100 | Metabolic pathways |
| M00089 | Triacylglycerol biosynthesis |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5954466 | Acyl chain remodeling of DAG and TAG |
| 5953288 | Fatty acid, triacylglycerol, and ketone body metabolism |
| 5953473 | Glycerophospholipid biosynthesis |
| 5953250 | Metabolism |
| 5953289 | Metabolism of lipids and lipoproteins |
| 5953474 | Phospholipid metabolism |
| 5953464 | Triglyceride Biosynthesis |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR007130 | Diacylglycerol acyltransferase |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Acyl-CoA + 1,2-diacylglycerol = CoA + triacylglycerol. |
| Catalytic Activity | Acyl-CoA + retinol = CoA + retinyl ester. |
| Enzyme Regulation | Inhibited by niacin |
| Function | Essential acyltransferase that catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. Required for synthesis and storage of intracellular triglycerides. Probably plays a central role in cytosolic lipid accumulation. In liver, is primarily responsible for incorporating endogenously synthesized fatty acids into triglycerides. Functions also as an acyl-CoA retinol acyltransferase (ARAT) (By similarity) |
| Pathway | Glycerolipid metabolism; triacylglycerol biosynthesis. |
| Similarity | Belongs to the diacylglycerol acyltransferase family |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein . Lipid droplet . |
| Subunit | Forms multimeric complexes consisting of several DGAT2 subunits |
Identical and Related Proteins
Unique RefSeq proteins for LMP012981 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 59891415 | RefSeq | NP_001012345 | 388 | diacylglycerol O-acyltransferase 2 |
Identical Sequences to LMP012981 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:59891415 | GenBank | AAH89846.1 | 388 | Diacylglycerol O-acyltransferase homolog 2 (mouse) [Rattus norvegicus] |
| GI:59891415 | SwissProt | Q5FVP8.1 | 388 | RecName: Full=Diacylglycerol O-acyltransferase 2; AltName: Full=Acyl-CoA retinol O-fatty-acyltransferase; Short=ARAT; Short=Retinol O-fatty-acyltransferase; AltName: Full=Diglyceride acyltransferase 2 [Rattus norvegicus] |
Related Sequences to LMP012981 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:59891415 | EMBL | CBF67547.1 | 388 | unnamed protein product [Mus musculus] |
| GI:59891415 | GenBank | AAH89846.1 | 388 | Diacylglycerol O-acyltransferase homolog 2 (mouse) [Rattus norvegicus] |
| GI:59891415 | GenBank | ACR92673.1 | 388 | Sequence 12 from patent US 7527962 |
| GI:59891415 | SwissProt | Q5FVP8.1 | 388 | RecName: Full=Diacylglycerol O-acyltransferase 2; AltName: Full=Acyl-CoA retinol O-fatty-acyltransferase; Short=ARAT; Short=Retinol O-fatty-acyltransferase; AltName: Full=Diglyceride acyltransferase 2 [Rattus norvegicus] |