Gene/Proteome Database (LMPD)
LMPD ID
LMP012985
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
glutathione peroxidase 6
Gene Symbol
Synonyms
OBPII; Ry2d1;
Alternate Names
glutathione peroxidase 6; GPx-6; GSHPx-6; odorant-metabolizing protein RY2D1;
Chromosome
17
Map Location
17q11
EC Number
1.11.1.9
Summary
a lipophilic molecule carrier in olfactory mucosa [RGD, Feb 2006]
Orthologs
Proteins
glutathione peroxidase 6 precursor | |
---|---|
Refseq ID | NP_671694 |
Protein GI | 22203761 |
UniProt ID | Q64625 |
mRNA ID | NM_147165 |
Length | 221 |
MTQQFWGPCLFSLFMAVLAQETLDPQKSKVDCNKGVAGTVYEYGANTLDGGEYVQFQQYAGKHILFVNVASFCGLTATYPELNTLQEELRPFNVSVLGFPCNQFGKQEPGKNSEILLGLKYVRPGGGFVPNFQLFEKGDVNGDNEQKVFSFLKSSCPPTSELLGSPEHLFWDPMKVHDIRWNFEKFLVGPDGAPVMRWFHQTPVRVVQSDIMEYLNQTRTQ | |
sig_peptide: 1..19 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2191 peptide sequence: MTQQFWGPCLFSLFMAVLA mat_peptide: 20..221 product: Glutathione peroxidase 6 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q64625.1) calculated_mol_wt: 22789 peptide sequence: QETLDPQKSKVDCNKGVAGTVYEYGANTLDGGEYVQFQQYAGKHILFVNVASFCGLTATYPELNTLQEELRPFNVSVLGFPCNQFGKQEPGKNSEILLGLKYVRPGGGFVPNFQLFEKGDVNGDNEQKVFSFLKSSCPPTSELLGSPEHLFWDPMKVHDIRWNFEKFLVGPDGAPVMRWFHQTPVRVVQSDIMEYLNQTRTQ |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
GO:0004602 | IEA:UniProtKB-EC | F | glutathione peroxidase activity |
GO:0006979 | IEA:InterPro | P | response to oxidative stress |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | 2 glutathione + H(2)O(2) = glutathione disulfide + 2 H(2)O. |
Similarity | Belongs to the glutathione peroxidase family |
Subcellular Location | Secreted. |
Tissue Specificity | Expressed in the Bowman glands. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012985 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
22203761 | RefSeq | NP_671694 | 221 | glutathione peroxidase 6 precursor |
Identical Sequences to LMP012985 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:22203761 | GenBank | AAA42094.1 | 221 | odorant-metabolizing protein [Rattus norvegicus] |
GI:22203761 | SwissProt | Q64625.1 | 221 | RecName: Full=Glutathione peroxidase 6; Short=GPx-6; Short=GSHPx-6; AltName: Full=Odorant-metabolizing protein RY2D1; Flags: Precursor [Rattus norvegicus] |
Related Sequences to LMP012985 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:22203761 | GenBank | AAA42094.1 | 221 | odorant-metabolizing protein [Rattus norvegicus] |
GI:22203761 | RefSeq | NP_663426.2 | 221 | glutathione peroxidase 6 precursor [Mus musculus] |
GI:22203761 | SwissProt | Q64625.1 | 221 | RecName: Full=Glutathione peroxidase 6; Short=GPx-6; Short=GSHPx-6; AltName: Full=Odorant-metabolizing protein RY2D1; Flags: Precursor [Rattus norvegicus] |
GI:22203761 | SwissProt | Q91WR8.2 | 221 | RecName: Full=Glutathione peroxidase 6; Short=GPx-6; Short=GSHPx-6; Flags: Precursor [Mus musculus] |