Gene/Proteome Database (LMPD)

LMPD ID
LMP012985
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
glutathione peroxidase 6
Gene Symbol
Synonyms
OBPII; Ry2d1;
Alternate Names
glutathione peroxidase 6; GPx-6; GSHPx-6; odorant-metabolizing protein RY2D1;
Chromosome
17
Map Location
17q11
EC Number
1.11.1.9
Summary
a lipophilic molecule carrier in olfactory mucosa [RGD, Feb 2006]
Orthologs

Proteins

glutathione peroxidase 6 precursor
Refseq ID NP_671694
Protein GI 22203761
UniProt ID Q64625
mRNA ID NM_147165
Length 221
MTQQFWGPCLFSLFMAVLAQETLDPQKSKVDCNKGVAGTVYEYGANTLDGGEYVQFQQYAGKHILFVNVASFCGLTATYPELNTLQEELRPFNVSVLGFPCNQFGKQEPGKNSEILLGLKYVRPGGGFVPNFQLFEKGDVNGDNEQKVFSFLKSSCPPTSELLGSPEHLFWDPMKVHDIRWNFEKFLVGPDGAPVMRWFHQTPVRVVQSDIMEYLNQTRTQ
sig_peptide: 1..19 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2191 peptide sequence: MTQQFWGPCLFSLFMAVLA mat_peptide: 20..221 product: Glutathione peroxidase 6 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q64625.1) calculated_mol_wt: 22789 peptide sequence: QETLDPQKSKVDCNKGVAGTVYEYGANTLDGGEYVQFQQYAGKHILFVNVASFCGLTATYPELNTLQEELRPFNVSVLGFPCNQFGKQEPGKNSEILLGLKYVRPGGGFVPNFQLFEKGDVNGDNEQKVFSFLKSSCPPTSELLGSPEHLFWDPMKVHDIRWNFEKFLVGPDGAPVMRWFHQTPVRVVQSDIMEYLNQTRTQ

Gene Information

Entrez Gene ID
Gene Name
glutathione peroxidase 6
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005576 IEA:UniProtKB-KW C extracellular region
GO:0004602 IEA:UniProtKB-EC F glutathione peroxidase activity
GO:0006979 IEA:InterPro P response to oxidative stress

KEGG Pathway Links

KEGG Pathway ID Description
ko00590 Arachidonic acid metabolism
rno00590 Arachidonic acid metabolism
ko00480 Glutathione metabolism
rno00480 Glutathione metabolism
ko04918 Thyroid hormone synthesis
rno04918 Thyroid hormone synthesis

Domain Information

InterPro Annotations

Accession Description
IPR000889 Glutathione peroxidase
IPR029759 Glutathione peroxidase active site
IPR029760 Glutathione peroxidase conserved site
IPR012336 Thioredoxin-like fold

UniProt Annotations

Entry Information

Gene Name
glutathione peroxidase 6
Protein Entry
GPX6_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity 2 glutathione + H(2)O(2) = glutathione disulfide + 2 H(2)O.
Similarity Belongs to the glutathione peroxidase family
Subcellular Location Secreted.
Tissue Specificity Expressed in the Bowman glands.

Identical and Related Proteins

Unique RefSeq proteins for LMP012985 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
22203761 RefSeq NP_671694 221 glutathione peroxidase 6 precursor

Identical Sequences to LMP012985 proteins

Reference Database Accession Length Protein Name
GI:22203761 GenBank AAA42094.1 221 odorant-metabolizing protein [Rattus norvegicus]
GI:22203761 SwissProt Q64625.1 221 RecName: Full=Glutathione peroxidase 6; Short=GPx-6; Short=GSHPx-6; AltName: Full=Odorant-metabolizing protein RY2D1; Flags: Precursor [Rattus norvegicus]

Related Sequences to LMP012985 proteins

Reference Database Accession Length Protein Name
GI:22203761 GenBank AAA42094.1 221 odorant-metabolizing protein [Rattus norvegicus]
GI:22203761 RefSeq NP_663426.2 221 glutathione peroxidase 6 precursor [Mus musculus]
GI:22203761 SwissProt Q64625.1 221 RecName: Full=Glutathione peroxidase 6; Short=GPx-6; Short=GSHPx-6; AltName: Full=Odorant-metabolizing protein RY2D1; Flags: Precursor [Rattus norvegicus]
GI:22203761 SwissProt Q91WR8.2 221 RecName: Full=Glutathione peroxidase 6; Short=GPx-6; Short=GSHPx-6; Flags: Precursor [Mus musculus]