Gene/Proteome Database (LMPD)
LMPD ID
LMP012991
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
Fas (TNFRSF6)-associated via death domain
Gene Symbol
Synonyms
Mort1;
Alternate Names
FAS-associated death domain protein; protein FADD;
Chromosome
1
Map Location
1q42
Summary
an important adaptor molecule in apoptosis signaling; may mediate hepatocyte death [RGD, Feb 2006]
Orthologs
Proteins
| FAS-associated death domain protein | |
|---|---|
| Refseq ID | NP_690920 |
| Protein GI | 23097354 |
| UniProt ID | Q8R2E7 |
| mRNA ID | NM_152937 |
| Length | 208 |
| MDPFLVLLHSLSSSLSGNDLTDLKFLCRERVSKRKLERVQSGLDLFSVLLEQNDLERGHTGLLRELLASLGRHDLLQRLDDFEAGATTAATPGEADLRVAFDIVCDNVGRDWKRLARELKVSEAKIDGIEERYPRSLSDRVRETLRVWKNVEKENASVAGLVKALRACRLNLVADLVEEALMAQGSVSKSDDTSSALRDSTVSFSETP | |
Gene Information
Entrez Gene ID
Gene Name
Fas (TNFRSF6)-associated via death domain
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0031265 | IDA:RGD | C | CD95 death-inducing signaling complex |
| GO:0044297 | IDA:RGD | C | cell body |
| GO:0005737 | IDA:RGD | C | cytoplasm |
| GO:0031264 | IDA:RGD | C | death-inducing signaling complex |
| GO:0045121 | IDA:RGD | C | membrane raft |
| GO:0043005 | IDA:RGD | C | neuron projection |
| GO:0043234 | IDA:RGD | C | protein complex |
| GO:0097342 | ISS:UniProtKB | C | ripoptosome |
| GO:0005123 | IPI:RGD | F | death receptor binding |
| GO:0002020 | IPI:RGD | F | protease binding |
| GO:0032403 | IPI:RGD | F | protein complex binding |
| GO:0005164 | IPI:RGD | F | tumor necrosis factor receptor binding |
| GO:0033077 | ISS:UniProtKB | P | T cell differentiation in thymus |
| GO:0043029 | ISS:UniProtKB | P | T cell homeostasis |
| GO:0036462 | IEA:Ensembl | P | TRAIL-activated apoptotic signaling pathway |
| GO:0097202 | IEA:Ensembl | P | activation of cysteine-type endopeptidase activity |
| GO:0006915 | ISS:UniProtKB | P | apoptotic process |
| GO:0071260 | IEA:Ensembl | P | cellular response to mechanical stimulus |
| GO:0051607 | IEA:Ensembl | P | defense response to virus |
| GO:0097192 | IEA:Ensembl | P | extrinsic apoptotic signaling pathway in absence of ligand |
| GO:0048535 | ISS:UniProtKB | P | lymph node development |
| GO:0097049 | IEA:Ensembl | P | motor neuron apoptotic process |
| GO:0097527 | IEA:Ensembl | P | necroptotic signaling pathway |
| GO:0070236 | ISS:UniProtKB | P | negative regulation of activation-induced cell death of T cells |
| GO:0060546 | IEA:Ensembl | P | negative regulation of necroptotic process |
| GO:2000454 | ISS:UniProtKB | P | positive regulation of CD8-positive, alpha-beta cytotoxic T cell extravasation |
| GO:0043123 | IEA:Ensembl | P | positive regulation of I-kappaB kinase/NF-kappaB signaling |
| GO:0001916 | ISS:UniProtKB | P | positive regulation of T cell mediated cytotoxicity |
| GO:0042104 | ISS:UniProtKB | P | positive regulation of activated T cell proliferation |
| GO:0002821 | ISS:UniProtKB | P | positive regulation of adaptive immune response |
| GO:0043065 | IEA:Ensembl | P | positive regulation of apoptotic process |
| GO:1902043 | IEA:Ensembl | P | positive regulation of extrinsic apoptotic signaling pathway via death domain receptors |
| GO:0032729 | ISS:UniProtKB | P | positive regulation of interferon-gamma production |
| GO:0032757 | IEA:Ensembl | P | positive regulation of interleukin-8 production |
| GO:0045651 | IEA:Ensembl | P | positive regulation of macrophage differentiation |
| GO:0045862 | IEA:Ensembl | P | positive regulation of proteolysis |
| GO:0045944 | IEA:Ensembl | P | positive regulation of transcription from RNA polymerase II promoter |
| GO:0032760 | IEA:Ensembl | P | positive regulation of tumor necrosis factor production |
| GO:0060340 | IEA:Ensembl | P | positive regulation of type I interferon-mediated signaling pathway |
| GO:0051291 | IPI:RGD | P | protein heterooligomerization |
| GO:0048536 | ISS:UniProtKB | P | spleen development |
| GO:0048538 | ISS:UniProtKB | P | thymus development |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko05010 | Alzheimer's disease |
| rno05010 | Alzheimer's disease |
| ko04210 | Apoptosis |
| rno04210 | Apoptosis |
| ko05142 | Chagas disease (American trypanosomiasis) |
| rno05142 | Chagas disease (American trypanosomiasis) |
| rno05161 | Hepatitis B |
| ko05168 | Herpes simplex infection |
| rno05168 | Herpes simplex infection |
| rno05200 | Pathways in cancer |
| ko04622 | RIG-I-like receptor signaling pathway |
| rno04622 | RIG-I-like receptor signaling pathway |
| ko04668 | TNF signaling pathway |
| rno04668 | TNF signaling pathway |
| ko04620 | Toll-like receptor signaling pathway |
| rno04620 | Toll-like receptor signaling pathway |
| ko05152 | Tuberculosis |
| rno05152 | Tuberculosis |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5953551 | Activated TLR4 signalling |
| 5953314 | Apoptosis |
| 5953376 | Caspase-8 activation by cleavage |
| 5953312 | Death Receptor Signalling |
| 5953375 | Dimerization of procaspase-8 |
| 5953313 | Extrinsic Pathway for Apoptosis |
| 5953311 | FasL/ CD95L signaling |
| 5953410 | Immune System |
| 5953409 | Innate Immune System |
| 5953559 | MyD88-independent cascade |
| 5953799 | NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10 |
| 5953789 | RIG-I/MDA5 mediated induction of IFN-alpha/beta pathways |
| 5954619 | Regulation by c-FLIP |
| 5953450 | TRAIL signaling |
| 5953558 | TRIF-mediated TLR3/TLR4 signaling |
| 5954589 | TRIF-mediated programmed cell death |
| 5953560 | Toll Like Receptor 3 (TLR3) Cascade |
| 5953552 | Toll Like Receptor 4 (TLR4) Cascade |
| 5953553 | Toll-Like Receptors Cascades |
Domain Information
UniProt Annotations
Entry Information
Gene Name
Fas (TNFRSF6)-associated via death domain
Protein Entry
Q8R2E7_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP012991 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 23097354 | RefSeq | NP_690920 | 208 | FAS-associated death domain protein |
Identical Sequences to LMP012991 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:23097354 | EMBL | CAD29628.1 | 208 | Fas death domain associated protein [Rattus norvegicus] |
| GI:23097354 | GenBank | AAN01113.1 | 208 | FADD/MORT1 protein with death effector domain [Rattus norvegicus] |
| GI:23097354 | GenBank | EDM12244.1 | 208 | Fas (TNFRSF6)-associated via death domain [Rattus norvegicus] |
Related Sequences to LMP012991 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:23097354 | DBBJ | BAC27384.1 | 205 | unnamed protein product [Mus musculus] |
| GI:23097354 | EMBL | CAD29628.1 | 208 | Fas death domain associated protein [Rattus norvegicus] |
| GI:23097354 | GenBank | AAN01113.1 | 208 | FADD/MORT1 protein with death effector domain [Rattus norvegicus] |
| GI:23097354 | GenBank | EDM12244.1 | 208 | Fas (TNFRSF6)-associated via death domain [Rattus norvegicus] |