Gene/Proteome Database (LMPD)

LMPD ID
LMP012991
Gene ID
266610
Species
Rattus norvegicus (Rat)
Gene Name
Fas (TNFRSF6)-associated via death domain
Gene Symbol
Fadd
Synonyms
Mort1;
Alternate Names
FAS-associated death domain protein; protein FADD;
Chromosome
1
Map Location
1q42
Summary
an important adaptor molecule in apoptosis signaling; may mediate hepatocyte death [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Fadd

Proteins

FAS-associated death domain protein
Refseq ID NP_690920
Protein GI 23097354
UniProt ID Q8R2E7
mRNA ID NM_152937
Length 208
MDPFLVLLHSLSSSLSGNDLTDLKFLCRERVSKRKLERVQSGLDLFSVLLEQNDLERGHTGLLRELLASLGRHDLLQRLDDFEAGATTAATPGEADLRVAFDIVCDNVGRDWKRLARELKVSEAKIDGIEERYPRSLSDRVRETLRVWKNVEKENASVAGLVKALRACRLNLVADLVEEALMAQGSVSKSDDTSSALRDSTVSFSETP

Gene Information

Entrez Gene ID
266610
Gene Name
Fas (TNFRSF6)-associated via death domain
Gene Symbol
Fadd
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0031265 IDA:RGD C CD95 death-inducing signaling complex
GO:0044297 IDA:RGD C cell body
GO:0005737 IDA:RGD C cytoplasm
GO:0031264 IDA:RGD C death-inducing signaling complex
GO:0045121 IDA:RGD C membrane raft
GO:0043005 IDA:RGD C neuron projection
GO:0043234 IDA:RGD C protein complex
GO:0097342 ISS:UniProtKB C ripoptosome
GO:0005123 IPI:RGD F death receptor binding
GO:0002020 IPI:RGD F protease binding
GO:0032403 IPI:RGD F protein complex binding
GO:0005164 IPI:RGD F tumor necrosis factor receptor binding
GO:0097202 IEA:Ensembl P activation of cysteine-type endopeptidase activity
GO:0006915 ISS:UniProtKB P apoptotic process
GO:0071260 IEA:Ensembl P cellular response to mechanical stimulus
GO:0051607 IEA:Ensembl P defense response to virus
GO:0097192 IEA:Ensembl P extrinsic apoptotic signaling pathway in absence of ligand
GO:0048535 ISS:UniProtKB P lymph node development
GO:0097049 IEA:Ensembl P motor neuron apoptotic process
GO:0097527 IEA:Ensembl P necroptotic signaling pathway
GO:0070236 ISS:UniProtKB P negative regulation of activation-induced cell death of T cells
GO:0060546 IEA:Ensembl P negative regulation of necroptotic process
GO:0042104 ISS:UniProtKB P positive regulation of activated T cell proliferation
GO:0002821 ISS:UniProtKB P positive regulation of adaptive immune response
GO:0043065 IEA:Ensembl P positive regulation of apoptotic process
GO:2000454 ISS:UniProtKB P positive regulation of CD8-positive, alpha-beta cytotoxic T cell extravasation
GO:1902043 IEA:Ensembl P positive regulation of extrinsic apoptotic signaling pathway via death domain receptors
GO:0043123 IEA:Ensembl P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0032729 ISS:UniProtKB P positive regulation of interferon-gamma production
GO:0032757 IEA:Ensembl P positive regulation of interleukin-8 production
GO:0045651 IEA:Ensembl P positive regulation of macrophage differentiation
GO:0045862 IEA:Ensembl P positive regulation of proteolysis
GO:0001916 ISS:UniProtKB P positive regulation of T cell mediated cytotoxicity
GO:0045944 IEA:Ensembl P positive regulation of transcription from RNA polymerase II promoter
GO:0032760 IEA:Ensembl P positive regulation of tumor necrosis factor production
GO:0060340 IEA:Ensembl P positive regulation of type I interferon-mediated signaling pathway
GO:0051291 IPI:RGD P protein heterooligomerization
GO:0048536 ISS:UniProtKB P spleen development
GO:0033077 ISS:UniProtKB P T cell differentiation in thymus
GO:0043029 ISS:UniProtKB P T cell homeostasis
GO:0048538 ISS:UniProtKB P thymus development
GO:0036462 IEA:Ensembl P TRAIL-activated apoptotic signaling pathway

KEGG Pathway Links

KEGG Pathway ID Description
ko05010 Alzheimer's disease
rno05010 Alzheimer's disease
ko04210 Apoptosis
rno04210 Apoptosis
ko05142 Chagas disease (American trypanosomiasis)
rno05142 Chagas disease (American trypanosomiasis)
rno05161 Hepatitis B
ko05168 Herpes simplex infection
rno05168 Herpes simplex infection
rno05200 Pathways in cancer
ko04622 RIG-I-like receptor signaling pathway
rno04622 RIG-I-like receptor signaling pathway
ko04668 TNF signaling pathway
rno04668 TNF signaling pathway
ko04620 Toll-like receptor signaling pathway
rno04620 Toll-like receptor signaling pathway
ko05152 Tuberculosis
rno05152 Tuberculosis

REACTOME Pathway Links

REACTOME Pathway ID Description
5953551 Activated TLR4 signalling
5953314 Apoptosis
5953376 Caspase-8 activation by cleavage
5953312 Death Receptor Signalling
5953375 Dimerization of procaspase-8
5953313 Extrinsic Pathway for Apoptosis
5953311 FasL/ CD95L signaling
5953410 Immune System
5953409 Innate Immune System
5953559 MyD88-independent cascade
5953799 NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10
5954619 Regulation by c-FLIP
5953789 RIG-I/MDA5 mediated induction of IFN-alpha/beta pathways
5953560 Toll Like Receptor 3 (TLR3) Cascade
5953552 Toll Like Receptor 4 (TLR4) Cascade
5953553 Toll-Like Receptors Cascades
5953450 TRAIL signaling
5954589 TRIF-mediated programmed cell death
5953558 TRIF-mediated TLR3/TLR4 signaling

Domain Information

InterPro Annotations

Accession Description
IPR000488 Death_domain
IPR011029 DEATH-like_dom
IPR001875 DED
IPR016729 FADD

UniProt Annotations

Entry Information

Gene Name
Fas (TNFRSF6)-associated via death domain
Protein Entry
Q8R2E7_RAT
UniProt ID
Q8R2E7
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP012991 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
23097354 RefSeq NP_690920 208 FAS-associated death domain protein

Identical Sequences to LMP012991 proteins

Reference Database Accession Length Protein Name
GI:23097354 EMBL CAD29628.1 208 Fas death domain associated protein [Rattus norvegicus]
GI:23097354 GenBank AAN01113.1 208 FADD/MORT1 protein with death effector domain [Rattus norvegicus]
GI:23097354 GenBank EDM12244.1 208 Fas (TNFRSF6)-associated via death domain [Rattus norvegicus]

Related Sequences to LMP012991 proteins

Reference Database Accession Length Protein Name
GI:23097354 DBBJ BAC27384.1 205 unnamed protein product [Mus musculus]
GI:23097354 EMBL CAD29628.1 208 Fas death domain associated protein [Rattus norvegicus]
GI:23097354 GenBank AAN01113.1 208 FADD/MORT1 protein with death effector domain [Rattus norvegicus]
GI:23097354 GenBank EDM12244.1 208 Fas (TNFRSF6)-associated via death domain [Rattus norvegicus]