Gene/Proteome Database (LMPD)
LMPD ID
LMP013005
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
glucosaminyl (N-acetyl) transferase 3, mucin type
Gene Symbol
Synonyms
dI/C2/C4GnT; beta-16-N-acetylglucosaminyltransferase;
Alternate Names
beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3; dIGnT; C2GnT-M; C2GnT-mucin type; beta-1,6-N-acetylglucosaminyltransferase;
Chromosome
8
Map Location
8q24
EC Number
2.4.1.102
Summary
glycosylation enzyme; transfers glycosyl groups to mucins; controls expression of type I antigens on cell surface [RGD, Feb 2006]
Orthologs
Proteins
beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 | |
---|---|
Refseq ID | NP_775434 |
Protein GI | 27545396 |
UniProt ID | Q8CH87 |
mRNA ID | NM_173312 |
Length | 437 |
MVSWRRFCWHYHGWTLGCYMLLAIIALKLSLRLKCDFDVMDLDSKEFQSQYCRDLLYKTLELPAKSSINCSGVIRGEQKAVTQALLNNLELKRKRQSFTEADYLSMTADCEHFKTQRKFIQVPLSKEEANFPIAYSMVIHEKIENFERLLRAVYTPQNIYCVHVDQKSSETFQQAVRAIVSCFPNVFIANKLVSVVYASWSRVQADLNCMEDLLQSPVPWEYLLNTCGTDFPIKTNAEMVKALKLLNGQNSMESEVPPPHKTFRWKYHYEVADTLYRTSKEKTPPPNNITMFTGNAYMVASRDFIEHVLSNSKARQLIEWVKDTYSPDEHLWATLQRASWMPGSDPLHPKFDLSDMRSIARLTKWQDHEGDIENGAPYTSCSGIHQRAICVYGSGDLHWILQNHHLLANKFDPKVDDNVLQCLEEYLRHKAIYGTEL |
Gene Information
Entrez Gene ID
Gene Name
glucosaminyl (N-acetyl) transferase 3, mucin type
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0008109 | IDA:RGD | F | N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase activity |
GO:0047225 | IEA:Ensembl | F | acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase activity |
GO:0003829 | IEA:UniProtKB-EC | F | beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase activity |
GO:0002426 | IEA:Ensembl | P | immunoglobulin production in mucosal tissue |
GO:0050892 | IEA:Ensembl | P | intestinal absorption |
GO:0060993 | IEA:Ensembl | P | kidney morphogenesis |
GO:0006486 | IEA:UniProtKB-UniPathway | P | protein glycosylation |
GO:0048729 | IEA:Ensembl | P | tissue morphogenesis |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
rno01100 | Metabolic pathways |
ko00512 | Mucin type O-Glycan biosynthesis |
rno00512 | Mucin type O-Glycan biosynthesis |
M00056 | O-glycan biosynthesis, mucin type core |
REACTOME Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR003406 | Glycosyl transferase, family 14 |
UniProt Annotations
Entry Information
Gene Name
glucosaminyl (N-acetyl) transferase 3, mucin type
Protein Entry
GCNT3_RAT
UniProt ID
Species
Rat
Comments
Comment Type | Description |
---|---|
Biophysicochemical Properties | pH dependence: Optimum pH is 7-8.5. ; |
Catalytic Activity | UDP-N-acetyl-D-glucosamine + beta-D- galactosyl-1,3-N-acetyl-D-galactosaminyl-R = UDP + beta-D- galactosyl-1,3-(N-acetyl-beta-D-glucosaminyl-1,6)-N-acetyl-D- galactosaminyl-R. |
Catalytic Activity | UDP-N-acetyl-D-glucosamine + beta-D- galactosyl-1,4-N-acetyl-D-glucosaminyl-R = UDP + N-acetyl-beta-D- glucosaminyl-1,6-beta-D-galactosyl-1,4-N-acetyl-D-glucosaminyl-R. |
Function | Glycosyltransferase that can synthesize all known mucin beta 6 N-acetylglucosaminides. Mediates core 2 and core 4 O-glycan branching, 2 important steps in mucin-type biosynthesis. Has also I-branching enzyme activity by converting linear into branched poly-N-acetyllactosaminoglycans, leading to introduce the blood group I antigen during embryonic development. |
Pathway | Protein modification; protein glycosylation. |
Ptm | N-glycosylated |
Similarity | Belongs to the glycosyltransferase 14 family |
Subcellular Location | Golgi apparatus membrane ; Single-pass type II membrane protein . |
Identical and Related Proteins
Unique RefSeq proteins for LMP013005 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
27545396 | RefSeq | NP_775434 | 437 | beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 |
Identical Sequences to LMP013005 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:27545396 | GenBank | EDL84193.1 | 437 | glucosaminyl (N-acetyl) transferase 3, mucin type, isoform CRA_a [Rattus norvegicus] |
GI:27545396 | RefSeq | XP_006243428.1 | 437 | PREDICTED: beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 isoform X1 [Rattus norvegicus] |
GI:27545396 | RefSeq | XP_008764442.1 | 437 | PREDICTED: beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 isoform X1 [Rattus norvegicus] |
GI:27545396 | SwissProt | Q8CH87.1 | 437 | RecName: Full=Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3; AltName: Full=C2GnT-mucin type; Short=C2GnT-M; AltName: Full=dI/C2/C4GnT; Short=dIGnT [Rattus norvegicus] |
Related Sequences to LMP013005 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:27545396 | DBBJ | BAC53607.1 | 437 | beta-1,6-N-acetylglucosaminyltransferase [Rattus norvegicus] |
GI:27545396 | RefSeq | XP_006243428.1 | 437 | PREDICTED: beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 isoform X1 [Rattus norvegicus] |
GI:27545396 | RefSeq | XP_008764442.1 | 437 | PREDICTED: beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 isoform X1 [Rattus norvegicus] |
GI:27545396 | SwissProt | Q8CH87.1 | 437 | RecName: Full=Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3; AltName: Full=C2GnT-mucin type; Short=C2GnT-M; AltName: Full=dI/C2/C4GnT; Short=dIGnT [Rattus norvegicus] |