Gene/Proteome Database (LMPD)
LMPD ID
LMP013039
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
solute carrier family 10 (sodium/bile acid cotransporter), member 6
Gene Symbol
Synonyms
Soat;
Alternate Names
solute carrier family 10 member 6; sodium-dependent organic anion transporter; solute carrier family 10 (sodium/bile acid cotransporter family), member 6;
Chromosome
14
Map Location
14p22
Summary
a putative member of the Slc10 transporter family which may be involved in estrone-3-sulfate and DHEAS transport in peripheral tissues [RGD, Feb 2006]
Orthologs
Proteins
solute carrier family 10 member 6 | |
---|---|
Refseq ID | NP_932166 |
Protein GI | 37591183 |
UniProt ID | Q70EX6 |
mRNA ID | NM_198049 |
Length | 370 |
MSADCEGNSTCPANSTEEDPPVGMEGQGSLKLVFTVLSAVMVGLVMFSFGCSVESRKLWLHLRRPWGIAVGLLCQFGLMPLTAYLLAIGFGLKPFQAIAVLIMGSCPGGTVSNVLTFWVDGDMDLSISMTTCSTVAALGMMPLCLYVYTRSWTLPQSLTIPYQSIGITLVSLVVPVASGIYVNYRWPKQATFILKVGAAVGGMLLLVVAVTGVVLAKGWNIDVTLLVISCIFPLVGHVMGFLLAFLTHQSWQRCRTISIETGAQNIQLCIAMMQLSFSAEYLVQLLNFALAYGLFQVLHGLLIVAAYQAYKRRQKSQYRRQHPECQDISSEKQPRETSAFLDKGAEAAVTLGLEQHHRTAELTSHVPSCE |
Gene Information
Entrez Gene ID
Gene Name
solute carrier family 10 (sodium/bile acid cotransporter), member 6
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0008508 | IEA:InterPro | F | bile acid:sodium symporter activity |
GO:0043250 | IDA:RGD | F | sodium-dependent organic anion transmembrane transporter activity |
GO:0043251 | IDA:RGD | P | sodium-dependent organic anion transport |
REACTOME Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR002657 | Bile acid:sodium symporter/arsenical resistance protein Acr3 |
UniProt Annotations
Entry Information
Gene Name
solute carrier family 10 (sodium/bile acid cotransporter), member 6
Protein Entry
SOAT_RAT
UniProt ID
Species
Rat
Comments
Comment Type | Description |
---|---|
Function | Transports sulfoconjugated steroid hormones, as well as taurolithocholic acid-3-sulfate and sulfoconjugated pyrenes in a sodium-dependent manner |
Ptm | Glycosylated |
Similarity | Belongs to the bile acid:sodium symporter (BASS) (TC 2.A.28) family |
Subcellular Location | Membrane ; Multi-pass membrane protein . |
Tissue Specificity | Highly expressed in heart, lung, spleen and adrenal gland. Moderately expressed in skeletal muscle, testis and small intestine |
Identical and Related Proteins
Unique RefSeq proteins for LMP013039 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
37591183 | RefSeq | NP_932166 | 370 | solute carrier family 10 member 6 |
Identical Sequences to LMP013039 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:37591183 | EMBL | CAE47478.1 | 370 | sodium-dependent organic anion transporter [Rattus norvegicus] |
GI:37591183 | SwissProt | Q70EX6.1 | 370 | RecName: Full=Solute carrier family 10 member 6; AltName: Full=Sodium-dependent organic anion transporter [Rattus norvegicus] |
Related Sequences to LMP013039 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:37591183 | EMBL | CAE47478.1 | 370 | sodium-dependent organic anion transporter [Rattus norvegicus] |
GI:37591183 | GenBank | AAI39344.1 | 373 | Solute carrier family 10 (sodium/bile acid cotransporter family), member 6 [Mus musculus] |
GI:37591183 | GenBank | AAI39347.1 | 373 | Solute carrier family 10 (sodium/bile acid cotransporter family), member 6 [Mus musculus] |
GI:37591183 | SwissProt | Q70EX6.1 | 370 | RecName: Full=Solute carrier family 10 member 6; AltName: Full=Sodium-dependent organic anion transporter [Rattus norvegicus] |