Gene/Proteome Database (LMPD)

LMPD ID
LMP013039
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
solute carrier family 10 (sodium/bile acid cotransporter), member 6
Gene Symbol
Synonyms
Soat;
Alternate Names
solute carrier family 10 member 6; sodium-dependent organic anion transporter; solute carrier family 10 (sodium/bile acid cotransporter family), member 6;
Chromosome
14
Map Location
14p22
Summary
a putative member of the Slc10 transporter family which may be involved in estrone-3-sulfate and DHEAS transport in peripheral tissues [RGD, Feb 2006]
Orthologs

Proteins

solute carrier family 10 member 6
Refseq ID NP_932166
Protein GI 37591183
UniProt ID Q70EX6
mRNA ID NM_198049
Length 370
MSADCEGNSTCPANSTEEDPPVGMEGQGSLKLVFTVLSAVMVGLVMFSFGCSVESRKLWLHLRRPWGIAVGLLCQFGLMPLTAYLLAIGFGLKPFQAIAVLIMGSCPGGTVSNVLTFWVDGDMDLSISMTTCSTVAALGMMPLCLYVYTRSWTLPQSLTIPYQSIGITLVSLVVPVASGIYVNYRWPKQATFILKVGAAVGGMLLLVVAVTGVVLAKGWNIDVTLLVISCIFPLVGHVMGFLLAFLTHQSWQRCRTISIETGAQNIQLCIAMMQLSFSAEYLVQLLNFALAYGLFQVLHGLLIVAAYQAYKRRQKSQYRRQHPECQDISSEKQPRETSAFLDKGAEAAVTLGLEQHHRTAELTSHVPSCE

Gene Information

Entrez Gene ID
Gene Name
solute carrier family 10 (sodium/bile acid cotransporter), member 6
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0008508 IEA:InterPro F bile acid:sodium symporter activity
GO:0043250 IDA:RGD F sodium-dependent organic anion transmembrane transporter activity
GO:0043251 IDA:RGD P sodium-dependent organic anion transport

REACTOME Pathway Links

REACTOME Pathway ID Description
5953264 SLC-mediated transmembrane transport
5953265 Transmembrane transport of small molecules
5953895 Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds

Domain Information

InterPro Annotations

Accession Description
IPR002657 Bile acid:sodium symporter/arsenical resistance protein Acr3

UniProt Annotations

Entry Information

Gene Name
solute carrier family 10 (sodium/bile acid cotransporter), member 6
Protein Entry
SOAT_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Function Transports sulfoconjugated steroid hormones, as well as taurolithocholic acid-3-sulfate and sulfoconjugated pyrenes in a sodium-dependent manner
Ptm Glycosylated
Similarity Belongs to the bile acid:sodium symporter (BASS) (TC 2.A.28) family
Subcellular Location Membrane ; Multi-pass membrane protein .
Tissue Specificity Highly expressed in heart, lung, spleen and adrenal gland. Moderately expressed in skeletal muscle, testis and small intestine

Identical and Related Proteins

Unique RefSeq proteins for LMP013039 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
37591183 RefSeq NP_932166 370 solute carrier family 10 member 6

Identical Sequences to LMP013039 proteins

Reference Database Accession Length Protein Name
GI:37591183 EMBL CAE47478.1 370 sodium-dependent organic anion transporter [Rattus norvegicus]
GI:37591183 SwissProt Q70EX6.1 370 RecName: Full=Solute carrier family 10 member 6; AltName: Full=Sodium-dependent organic anion transporter [Rattus norvegicus]

Related Sequences to LMP013039 proteins

Reference Database Accession Length Protein Name
GI:37591183 EMBL CAE47478.1 370 sodium-dependent organic anion transporter [Rattus norvegicus]
GI:37591183 GenBank AAI39344.1 373 Solute carrier family 10 (sodium/bile acid cotransporter family), member 6 [Mus musculus]
GI:37591183 GenBank AAI39347.1 373 Solute carrier family 10 (sodium/bile acid cotransporter family), member 6 [Mus musculus]
GI:37591183 SwissProt Q70EX6.1 370 RecName: Full=Solute carrier family 10 member 6; AltName: Full=Sodium-dependent organic anion transporter [Rattus norvegicus]