Gene/Proteome Database (LMPD)
LMPD ID
LMP013051
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
phytanoyl-CoA 2-hydroxylase interacting protein
Gene Symbol
Alternate Names
phytanoyl-CoA hydroxylase-interacting protein; PAHXAP1; PAHX-AP1; phytanoyl-CoA hydroxylase interacting protein; phytanoyl-CoA hydroxylase-associated protein 1;
Chromosome
15
Map Location
15p11
Proteins
phytanoyl-CoA hydroxylase-interacting protein | |
---|---|
Refseq ID | NP_001017376 |
Protein GI | 62821761 |
UniProt ID | Q568Z9 |
mRNA ID | NM_001017376 |
Length | 330 |
MELLSTPHSIEINNITCDSFRISWAMEDSDLERVTHYFIDLNKKENKNSNKFKHRDVPTKLVAKAVPLPMTVRGHWFLSPRTEYSVAVQTAVKQSDGEYLVSGWSETVEFCTGDYAKEHLAQLQEKAEQIAGRMLRFSVFYRNHHKEYFQHARTHCGNVLQPYLKDNSGSHGSPTSGMLHGVFFSCNTEFNTGQPPQDSPYGRWRFQIPAQRLFNPSTNLYFADFYCMYTAYHYAILVLAPKGSLGDRFCRDRLPLLDIACNKFLTCSVEDGELIFRHAQDLILEIIYTEPVDLSLGTLGEISGHQLMSLSTADAKKDPSCKTCNISVGR |
Gene Information
Domain Information
UniProt Annotations
Entry Information
Gene Name
phytanoyl-CoA 2-hydroxylase interacting protein
Protein Entry
PHYIP_RAT
UniProt ID
Species
Rat
Comments
Comment Type | Description |
---|---|
Function | Its interaction with PHYH suggests a role in the development of the central system |
Function | Its interaction with PHYH suggests a role in the development of the central system. {ECO:0000250}. |
Similarity | Belongs to the PHYHIP family |
Similarity | Belongs to the PHYHIP family. {ECO:0000305}. |
Similarity | Contains 1 fibronectin type-III domain |
Similarity | Contains 1 fibronectin type-III domain. {ECO:0000255|PROSITE-ProRule:PRU00316}. |
Subunit | Interacts with PHYH and BAI1 |
Subunit | Interacts with PHYH and BAI1. {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP013051 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
62821761 | RefSeq | NP_001017376 | 330 | phytanoyl-CoA hydroxylase-interacting protein |
Identical Sequences to LMP013051 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:62821761 | RefSeq | XP_006518442.1 | 330 | PREDICTED: phytanoyl-CoA hydroxylase-interacting protein isoform X1 [Mus musculus] |
GI:62821761 | RefSeq | XP_006518443.1 | 330 | PREDICTED: phytanoyl-CoA hydroxylase-interacting protein isoform X2 [Mus musculus] |
GI:62821761 | RefSeq | XP_006989161.1 | 330 | PREDICTED: phytanoyl-CoA hydroxylase-interacting protein [Peromyscus maniculatus bairdii] |
GI:62821761 | RefSeq | XP_008769059.1 | 330 | PREDICTED: phytanoyl-CoA hydroxylase-interacting protein [Rattus norvegicus] |
Related Sequences to LMP013051 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:62821761 | RefSeq | XP_006252322.1 | 330 | PREDICTED: phytanoyl-CoA hydroxylase-interacting protein [Rattus norvegicus] |
GI:62821761 | RefSeq | XP_006252355.1 | 330 | PREDICTED: phytanoyl-CoA hydroxylase-interacting protein isoform X1 [Rattus norvegicus] |
GI:62821761 | RefSeq | XP_006518442.1 | 330 | PREDICTED: phytanoyl-CoA hydroxylase-interacting protein isoform X1 [Mus musculus] |
GI:62821761 | RefSeq | XP_006518443.1 | 330 | PREDICTED: phytanoyl-CoA hydroxylase-interacting protein isoform X2 [Mus musculus] |