Gene/Proteome Database (LMPD)

LMPD ID
LMP013051
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
phytanoyl-CoA 2-hydroxylase interacting protein
Gene Symbol
Alternate Names
phytanoyl-CoA hydroxylase-interacting protein; PAHXAP1; PAHX-AP1; phytanoyl-CoA hydroxylase interacting protein; phytanoyl-CoA hydroxylase-associated protein 1;
Chromosome
15
Map Location
15p11

Proteins

phytanoyl-CoA hydroxylase-interacting protein
Refseq ID NP_001017376
Protein GI 62821761
UniProt ID Q568Z9
mRNA ID NM_001017376
Length 330
MELLSTPHSIEINNITCDSFRISWAMEDSDLERVTHYFIDLNKKENKNSNKFKHRDVPTKLVAKAVPLPMTVRGHWFLSPRTEYSVAVQTAVKQSDGEYLVSGWSETVEFCTGDYAKEHLAQLQEKAEQIAGRMLRFSVFYRNHHKEYFQHARTHCGNVLQPYLKDNSGSHGSPTSGMLHGVFFSCNTEFNTGQPPQDSPYGRWRFQIPAQRLFNPSTNLYFADFYCMYTAYHYAILVLAPKGSLGDRFCRDRLPLLDIACNKFLTCSVEDGELIFRHAQDLILEIIYTEPVDLSLGTLGEISGHQLMSLSTADAKKDPSCKTCNISVGR

Gene Information

Entrez Gene ID
Gene Name
phytanoyl-CoA 2-hydroxylase interacting protein
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description

Domain Information

InterPro Annotations

Accession Description
IPR003961 Fibronectin type III
IPR013783 Immunoglobulin-like fold

UniProt Annotations

Entry Information

Gene Name
phytanoyl-CoA 2-hydroxylase interacting protein
Protein Entry
PHYIP_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Function Its interaction with PHYH suggests a role in the development of the central system
Function Its interaction with PHYH suggests a role in the development of the central system. {ECO:0000250}.
Similarity Belongs to the PHYHIP family
Similarity Belongs to the PHYHIP family. {ECO:0000305}.
Similarity Contains 1 fibronectin type-III domain
Similarity Contains 1 fibronectin type-III domain. {ECO:0000255|PROSITE-ProRule:PRU00316}.
Subunit Interacts with PHYH and BAI1
Subunit Interacts with PHYH and BAI1. {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP013051 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
62821761 RefSeq NP_001017376 330 phytanoyl-CoA hydroxylase-interacting protein

Identical Sequences to LMP013051 proteins

Reference Database Accession Length Protein Name
GI:62821761 RefSeq XP_006518442.1 330 PREDICTED: phytanoyl-CoA hydroxylase-interacting protein isoform X1 [Mus musculus]
GI:62821761 RefSeq XP_006518443.1 330 PREDICTED: phytanoyl-CoA hydroxylase-interacting protein isoform X2 [Mus musculus]
GI:62821761 RefSeq XP_006989161.1 330 PREDICTED: phytanoyl-CoA hydroxylase-interacting protein [Peromyscus maniculatus bairdii]
GI:62821761 RefSeq XP_008769059.1 330 PREDICTED: phytanoyl-CoA hydroxylase-interacting protein [Rattus norvegicus]

Related Sequences to LMP013051 proteins

Reference Database Accession Length Protein Name
GI:62821761 RefSeq XP_006252322.1 330 PREDICTED: phytanoyl-CoA hydroxylase-interacting protein [Rattus norvegicus]
GI:62821761 RefSeq XP_006252355.1 330 PREDICTED: phytanoyl-CoA hydroxylase-interacting protein isoform X1 [Rattus norvegicus]
GI:62821761 RefSeq XP_006518442.1 330 PREDICTED: phytanoyl-CoA hydroxylase-interacting protein isoform X1 [Mus musculus]
GI:62821761 RefSeq XP_006518443.1 330 PREDICTED: phytanoyl-CoA hydroxylase-interacting protein isoform X2 [Mus musculus]