Gene/Proteome Database (LMPD)
LMPD ID
LMP013061
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 6
Gene Symbol
Synonyms
RGD1310520;
Alternate Names
glycerol-3-phosphate acyltransferase 6; glycerol-3-phosphate acyltransferase 4; lysophosphatidic acid acyltransferase zeta; putative lysophosphatidic acid acyltransferase; 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta);
Chromosome
16
Map Location
16q12.5
Proteins
glycerol-3-phosphate acyltransferase 6 | |
---|---|
Refseq ID | NP_001041314 |
Protein GI | 114326232 |
UniProt ID | Q0ZFS7 |
mRNA ID | NM_001047849 |
Length | 456 |
MFLLLPFDSLIVNLLGISLTVLFTLLLVFIIVPAVFGVSFGIRKLYMKTLLKIFAWATLRMERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIRRSGSNKALDKTPEFELSDIFYFCRKGMETIMDDEVTKRFSAEELESWNLLSRTNYNFQYISLRLTILWGLGVLIRYCFLLPLRIALAFTGISLLVAGTTVVGYLPSGRFKEFLSKHVHLMCYRICVRALTAIITYHNRKNRPRNGGICVANHTSPIDVIILASDGYYAMVGQVHGGLMGVIQRAMVKACPHVWFERSEVKDRHLVAKRLTEHVQDKSKLPILIFPEGTCINNTSVMMFKKGSFEIGATVYPVAIKYDPQFGDAFWNSSKYGMVTYLLRMMTSWAIVCSVWYLPPMTREKEEDAVQFANRVKSAIARQGGLVDLLWDGGLKREKVKDTFKEEQQKLYSKMIVGNHEDRSRS |
Gene Information
Entrez Gene ID
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 6
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:Ensembl | C | endoplasmic reticulum |
GO:0016020 | IEA:Ensembl | C | membrane |
GO:0004366 | IEA:Ensembl | F | glycerol-3-phosphate O-acyltransferase activity |
GO:0006637 | IEA:Ensembl | P | acyl-CoA metabolic process |
GO:0046339 | IEA:Ensembl | P | diacylglycerol metabolic process |
GO:0006631 | IEA:Ensembl | P | fatty acid metabolic process |
GO:0002071 | IEA:Ensembl | P | glandular epithelial cell maturation |
GO:0007595 | IEA:Ensembl | P | lactation |
GO:0006656 | IEA:Ensembl | P | phosphatidylcholine biosynthetic process |
GO:0040014 | IEA:Ensembl | P | regulation of multicellular organism growth |
GO:0019432 | IEA:Ensembl | P | triglyceride biosynthetic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko00561 | Glycerolipid metabolism |
rno00561 | Glycerolipid metabolism |
ko00564 | Glycerophospholipid metabolism |
rno00564 | Glycerophospholipid metabolism |
rno01100 | Metabolic pathways |
M00089 | Triacylglycerol biosynthesis |
REACTOME Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR002123 | Phospholipid/glycerol acyltransferase |
UniProt Annotations
Entry Information
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 6
Protein Entry
Q0ZFS7_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP013061 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
114326232 | RefSeq | NP_001041314 | 456 | glycerol-3-phosphate acyltransferase 6 |
Identical Sequences to LMP013061 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:114326232 | GenBank | ABG37971.1 | 456 | unknown [Rattus norvegicus] |
GI:114326232 | GenBank | EDM09028.1 | 456 | 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta), isoform CRA_a [Rattus norvegicus] |
GI:114326232 | GenBank | AAI61809.1 | 456 | 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta) [Rattus norvegicus] |
Related Sequences to LMP013061 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:114326232 | GenBank | ABG37971.1 | 456 | unknown [Rattus norvegicus] |
GI:114326232 | GenBank | EDM09028.1 | 456 | 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta), isoform CRA_a [Rattus norvegicus] |
GI:114326232 | GenBank | AAI61809.1 | 456 | 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta) [Rattus norvegicus] |
GI:114326232 | RefSeq | XP_006983035.1 | 456 | PREDICTED: glycerol-3-phosphate acyltransferase 4 [Peromyscus maniculatus bairdii] |