Gene/Proteome Database (LMPD)
LMPD ID
LMP013093
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
apolipoprotein C-II
Gene Symbol
Synonyms
RGD1560725;
Alternate Names
apolipoprotein C-II; apolipoprotein C2;
Chromosome
1
Map Location
1q21
Summary
cofactor and activator of lipoprotein lipase; crucial for the hydrolysis of triacylglycerols and very-low-density lipoproteins; mRNA found mainly in the liver [RGD, Feb 2006]
Orthologs
Proteins
apolipoprotein C-II precursor | |
---|---|
Refseq ID | NP_001078821 |
Protein GI | 145553986 |
UniProt ID | G3V8D4 |
mRNA ID | NM_001085352 |
Length | 97 |
MGSRFFLALFLALLVLGNEVQGTEEDDPGSSALLDTVQEHLFSYWNSAKAAAGELYQKTYLTSVDEKLRDMYSKSSAAMTTYAGIFTDQLLTLLKGE | |
sig_peptide: 1..22 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2396 peptide sequence: MGSRFFLALFLALLVLGNEVQG |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0042627 | IEA:InterPro | C | chylomicron |
GO:0008047 | IEA:InterPro | F | enzyme activator activity |
GO:0006629 | IEA:InterPro | P | lipid metabolic process |
GO:0006869 | IEA:InterPro | P | lipid transport |
GO:0042953 | IDA:RGD | P | lipoprotein transport |
GO:0042493 | IEP:RGD | P | response to drug |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5953879 | Chylomicron-mediated lipid transport |
5953253 | Disease |
5953382 | Diseases associated with visual transduction |
5954088 | HDL-mediated lipid transport |
5953754 | Lipid digestion, mobilization, and transport |
5953836 | Lipoprotein metabolism |
5953250 | Metabolism |
5953289 | Metabolism of lipids and lipoproteins |
5954392 | Retinoid metabolism and transport |
5953381 | Signal Transduction |
5953380 | Visual phototransduction |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP013093 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
145553986 | RefSeq | NP_001078821 | 97 | apolipoprotein C-II precursor |
Identical Sequences to LMP013093 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:145553986 | GenBank | EDM08174.1 | 97 | apolipoprotein C-II (predicted) [Rattus norvegicus] |
Related Sequences to LMP013093 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:145553986 | GenBank | EDM08174.1 | 97 | apolipoprotein C-II (predicted) [Rattus norvegicus] |
GI:145553986 | RefSeq | XP_005370362.1 | 132 | PREDICTED: apolipoprotein C-IV-like isoform X1 [Microtus ochrogaster] |
GI:145553986 | RefSeq | XP_005370365.1 | 100 | PREDICTED: apolipoprotein C-IV-like isoform X4 [Microtus ochrogaster] |
GI:145553986 | RefSeq | XP_005370366.1 | 100 | PREDICTED: apolipoprotein C-IV-like isoform X5 [Microtus ochrogaster] |