Gene/Proteome Database (LMPD)
LMPD ID
LMP013095
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
sulfotransferase family, cytosolic, 2B, member 1
Gene Symbol
Synonyms
ST2B1;
Alternate Names
sulfotransferase family cytosolic 2B member 1; sulfotransferase 2B; sulfotransferase 2B1; alcohol sulfotransferase; hydroxysteroid sulfotransferase 2; sult2b1 {ECO:0000312|RGD:1308882};
Chromosome
1
Map Location
1q22
EC Number
2.8.2.2
Proteins
| sulfotransferase family cytosolic 2B member 1 | |
|---|---|
| Refseq ID | NP_001034754 |
| Protein GI | 89145411 |
| UniProt ID | Q29YR5 |
| mRNA ID | NM_001039665 |
| Length | 375 |
| MSPWSRNTCYSSPSMRLDRSCARNTARWGHWKEGKPHGGLTGETEAGSSWNGGSESQKLQGEYFRYKGIPFPVGMYTPESLSLAENTSNVRDDDIFIVTYPKSGTNWMIEIICLILKDGDPSWIRSEPIWQRAPWCETTISAFSLPERPSPRLMCSHLPIELFTKAAFSSKAKVIYLGRNPRDVVVSLYYYSKIAVQLKDPGTPEQFLQNFLKGEVQFGSWFDHIKGWIRMRGRENFLFITYEELQQDLRGSVQLICEFLGRPLGEEALSSVVAHSAFAAMKANNMSNYTLLPASLLDHRQGAFLRKGISGDWKNHFTVAQSETFDQVYREQMHGLPSFPWDRSAEDGSPDGETEPSPSPSPGLASDDPNPGSSQ | |
Gene Information
Entrez Gene ID
Gene Name
sulfotransferase family, cytosolic, 2B, member 1
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0004027 | IEA:UniProtKB-EC | F | alcohol sulfotransferase activity |
| GO:0050294 | IEA:Ensembl | F | steroid sulfotransferase activity |
| GO:0008202 | IEA:UniProtKB-KW | P | steroid metabolic process |
| GO:0000103 | IEA:Ensembl | P | sulfate assimilation |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00140 | Steroid hormone biosynthesis |
| rno00140 | Steroid hormone biosynthesis |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
sulfotransferase family, cytosolic, 2B, member 1
Protein Entry
ST2B1_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1 ; Synonyms=SULT2B1b ; IsoId=Q29YR5-1; Sequence=Displayed; Name=2 ; Synonyms=SULT2B1a ; IsoId=Q29YR5-2; Sequence=VSP_052079; |
| Biophysicochemical Properties | Kinetic parameters: KM=8.9 uM for pregnenolone (isoform 2) ; KM=17.9 uM for dehydroepiandrosterone (DHEA) (isoform A) ; KM=1.7 uM for cholesterol (isoform 1) ; |
| Catalytic Activity | 3'-phosphoadenylyl sulfate + an alcohol = adenosine 3',5'-bisphosphate + an alkyl sulfate |
| Function | Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates hydroxysteroids such as dehydroepiandrosterone. Isoform 1 is required for production of cholesterol sulfate essential for normal skin development whereas isoform 2 produces pregnenolone sulfate, an essential neurosteroid during development of the central nervous system (By similarity) |
| Similarity | Belongs to the sulfotransferase 1 family |
| Subcellular Location | Cytoplasm . Microsome . |
| Tissue Specificity | Isoform 1 is expressed in skin and testis. Higher level of isoform 2 expressed in skin and intestine, moderate level in the kidney, low level in liver, stomach and placenta |
Identical and Related Proteins
Unique RefSeq proteins for LMP013095 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 89145411 | RefSeq | NP_001034754 | 375 | sulfotransferase family cytosolic 2B member 1 |
Identical Sequences to LMP013095 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:89145411 | GenBank | AAX34390.1 | 375 | SULT2B1a [Rattus norvegicus] |
Related Sequences to LMP013095 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:89145411 | GenBank | AAX34390.1 | 375 | SULT2B1a [Rattus norvegicus] |
| GI:89145411 | GenBank | AAX34391.1 | 340 | SULT2B1b [Rattus norvegicus] |
| GI:89145411 | RefSeq | XP_005139418.1 | 375 | PREDICTED: LOW QUALITY PROTEIN: sulfotransferase family, cytosolic, 2B, member 1 [Mesocricetus auratus] |
| GI:89145411 | SwissProt | Q29YR5.1 | 340 | RecName: Full=Sulfotransferase family cytosolic 2B member 1; Short=ST2B1; Short=Sulfotransferase 2B1; AltName: Full=Alcohol sulfotransferase; AltName: Full=Hydroxysteroid sulfotransferase 2 [Rattus norvegicus] |