Gene/Proteome Database (LMPD)

LMPD ID
LMP013112
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
methylmalonyl CoA epimerase
Gene Symbol
Alternate Names
methylmalonyl-CoA epimerase, mitochondrial;
Chromosome
1
Map Location
1q22

Proteins

methylmalonyl-CoA epimerase, mitochondrial
Refseq ID NP_001099811
Protein GI 157821869
UniProt ID D4A197
mRNA ID NM_001106341
Length 178
MRLVVKAAALAAGATGLFSRVQTPVAAGRSFSTSPSQHQASSPVWKLGRLNHVAIAVPDLEKASSFYRDVLGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGSDSPIAGFLQKNKAGGMHHVCIEVDNINAAVMDLKKQKIRSLSDEAKIGAHGKPVIFLHPKDCGGVLVELEQA

Gene Information

Entrez Gene ID
Gene Name
methylmalonyl CoA epimerase
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005739 IEA:Ensembl C mitochondrion
GO:0004493 IEA:Ensembl F methylmalonyl-CoA epimerase activity
GO:0046491 IEA:Ensembl P L-methylmalonyl-CoA metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
ko01200 Carbon metabolism
rno01200 Carbon metabolism
ko00630 Glyoxylate and dicarboxylate metabolism
rno00630 Glyoxylate and dicarboxylate metabolism
rno01100 Metabolic pathways
ko00640 Propanoate metabolism
rno00640 Propanoate metabolism
ko00280 Valine, leucine and isoleucine degradation
rno00280 Valine, leucine and isoleucine degradation

REACTOME Pathway Links

REACTOME Pathway ID Description
5953288 Fatty acid, triacylglycerol, and ketone body metabolism
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5953287 Mitochondrial Fatty Acid Beta-Oxidation
5953286 Propionyl-CoA catabolism

Domain Information

InterPro Annotations

Accession Description
IPR029068 Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
IPR017515 Methylmalonyl-CoA epimerase

UniProt Annotations

Entry Information

Gene Name
methylmalonyl CoA epimerase
Protein Entry
D4A197_RAT
UniProt ID
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP013112 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
157821869 RefSeq NP_001099811 178 methylmalonyl-CoA epimerase, mitochondrial

Identical Sequences to LMP013112 proteins

Reference Database Accession Length Protein Name
GI:157821869 GenBank EDM08394.1 178 methylmalonyl CoA epimerase (predicted), isoform CRA_d [Rattus norvegicus]

Related Sequences to LMP013112 proteins

Reference Database Accession Length Protein Name
GI:157821869 GenBank AAH38157.1 178 Methylmalonyl CoA epimerase [Mus musculus]
GI:157821869 GenBank EDL07253.1 178 methylmalonyl CoA epimerase, isoform CRA_a [Mus musculus]
GI:157821869 GenBank EDM08394.1 178 methylmalonyl CoA epimerase (predicted), isoform CRA_d [Rattus norvegicus]
GI:157821869 RefSeq NP_082902.1 178 methylmalonyl-CoA epimerase, mitochondrial precursor [Mus musculus]