Gene/Proteome Database (LMPD)
LMPD ID
LMP013117
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 3
Gene Symbol
Alternate Names
diphosphoinositol polyphosphate phosphohydrolase 1; DIPP-1; nudix motif 3; nudix-type motif 3; nucleoside diphosphate-linked moiety X motif 3; diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 1; nudix (nucleotide diphosphate linked moiety X)-type motif 3;
Chromosome
20
Map Location
20p12
EC Number
3.6.1.52
Proteins
| diphosphoinositol polyphosphate phosphohydrolase 1 | |
|---|---|
| Refseq ID | NP_001019414 |
| Protein GI | 66730447 |
| UniProt ID | Q566C7 |
| mRNA ID | NM_001024243 |
| Length | 168 |
| MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEEAVKVLQYHKPVQASYFEALRQGYSANNGTPVLPTTYSSSMSGIR | |
Gene Information
Entrez Gene ID
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 3
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0008486 | ISS:UniProtKB | F | diphosphoinositol-polyphosphate diphosphatase activity |
| GO:0052840 | IEA:UniProtKB-EC | F | inositol diphosphate tetrakisphosphate diphosphatase activity |
| GO:0052846 | IEA:UniProtKB-EC | F | inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 1-diphosphatase activity |
| GO:0052847 | IEA:UniProtKB-EC | F | inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity |
| GO:0052843 | IEA:UniProtKB-EC | F | inositol-1-diphosphate-2,3,4,5,6-pentakisphosphate diphosphatase activity |
| GO:0052848 | IEA:UniProtKB-EC | F | inositol-3,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity |
| GO:0052844 | IEA:UniProtKB-EC | F | inositol-3-diphosphate-1,2,4,5,6-pentakisphosphate diphosphatase activity |
| GO:0052845 | IEA:UniProtKB-EC | F | inositol-5-diphosphate-1,2,3,4,6-pentakisphosphate diphosphatase activity |
| GO:0000287 | ISS:UniProtKB | F | magnesium ion binding |
| GO:0071544 | ISS:UniProtKB | P | diphosphoinositol polyphosphate catabolic process |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 3
Protein Entry
NUDT3_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | Kinetic parameters: KM=340 nM for PP-InsP5; KM=34 nM for [PP]2-InsP4; |
| Catalytic Activity | Diphospho-myo-inositol polyphosphate + H(2)O = myo-inositol polyphosphate + phosphate |
| Cofactor | Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence= ; Note=Binds 3 Mg(2+) ions per subunit. ; |
| Enzyme Regulation | Inhibited by fluoride and InsP6 |
| Function | Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate) and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction. InsP6 (inositol hexakisphophate) is not a substrate. Acts as a negative regulator of the ERK1/2 pathway. Also able to catalyze the hydrolysis of dinucleoside oligophosphates, with Ap6A and Ap5A being the preferred substrates. The major reaction products are ADP and p4a from Ap6A and ADP and ATP from Ap5A. Also able to hydrolyze 5- phosphoribose 1-diphosphate |
| Similarity | Belongs to the Nudix hydrolase family. DIPP subfamily |
| Similarity | Contains 1 nudix hydrolase domain |
| Subcellular Location | Cytoplasm . |
| Subunit | Monomer |
Identical and Related Proteins
Unique RefSeq proteins for LMP013117 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 66730447 | RefSeq | NP_001019414 | 168 | diphosphoinositol polyphosphate phosphohydrolase 1 |
Identical Sequences to LMP013117 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:66730447 | GenBank | AAH93618.1 | 168 | Nudix (nucleoside diphosphate linked moiety X)-type motif 3 [Rattus norvegicus] |
| GI:66730447 | GenBank | EDL96893.1 | 168 | nudix (nucleotide diphosphate linked moiety X)-type motif 3 [Rattus norvegicus] |
| GI:66730447 | SwissProt | Q566C7.1 | 168 | RecName: Full=Diphosphoinositol polyphosphate phosphohydrolase 1; Short=DIPP-1; AltName: Full=Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 1; AltName: Full=Nucleoside diphosphate-linked moiety X motif 3; Short=Nudix motif 3 [Rattus norvegicus] |
Related Sequences to LMP013117 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:66730447 | GenBank | AAF74761.1 | 168 | diphosphoinositol polyphosphate phosphohydrolase [Mus musculus] |
| GI:66730447 | GenBank | AAH93618.1 | 168 | Nudix (nucleoside diphosphate linked moiety X)-type motif 3 [Rattus norvegicus] |
| GI:66730447 | GenBank | EDL96893.1 | 168 | nudix (nucleotide diphosphate linked moiety X)-type motif 3 [Rattus norvegicus] |
| GI:66730447 | SwissProt | Q566C7.1 | 168 | RecName: Full=Diphosphoinositol polyphosphate phosphohydrolase 1; Short=DIPP-1; AltName: Full=Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 1; AltName: Full=Nucleoside diphosphate-linked moiety X motif 3; Short=Nudix motif 3 [Rattus norvegicus] |