Gene/Proteome Database (LMPD)

LMPD ID
LMP013117
Gene ID
294292
Species
Rattus norvegicus (Rat)
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 3
Gene Symbol
Nudt3
Alternate Names
diphosphoinositol polyphosphate phosphohydrolase 1; DIPP-1; nudix motif 3; nudix-type motif 3; nucleoside diphosphate-linked moiety X motif 3; diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 1; nudix (nucleotide diphosphate linked moiety X)-type motif 3;
Chromosome
20
Map Location
20p12
EC Number
3.6.1.52

Proteins

diphosphoinositol polyphosphate phosphohydrolase 1
Refseq ID NP_001019414
Protein GI 66730447
UniProt ID Q566C7
mRNA ID NM_001024243
Length 168
MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEEAVKVLQYHKPVQASYFEALRQGYSANNGTPVLPTTYSSSMSGIR

Gene Information

Entrez Gene ID
294292
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 3
Gene Symbol
Nudt3
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0008486 ISS:UniProtKB F diphosphoinositol-polyphosphate diphosphatase activity
GO:0052840 IEA:UniProtKB-EC F inositol diphosphate tetrakisphosphate diphosphatase activity
GO:0052846 IEA:UniProtKB-EC F inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 1-diphosphatase activity
GO:0052847 IEA:UniProtKB-EC F inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity
GO:0052843 IEA:UniProtKB-EC F inositol-1-diphosphate-2,3,4,5,6-pentakisphosphate diphosphatase activity
GO:0052848 IEA:UniProtKB-EC F inositol-3,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity
GO:0052844 IEA:UniProtKB-EC F inositol-3-diphosphate-1,2,4,5,6-pentakisphosphate diphosphatase activity
GO:0052845 IEA:UniProtKB-EC F inositol-5-diphosphate-1,2,3,4,6-pentakisphosphate diphosphatase activity
GO:0000287 ISS:UniProtKB F magnesium ion binding
GO:0071544 ISS:UniProtKB P diphosphoinositol polyphosphate catabolic process

REACTOME Pathway Links

REACTOME Pathway ID Description
5954515 Inositol phosphate metabolism
5953250 Metabolism
5954518 Synthesis of pyrophosphates in the cytosol

Domain Information

InterPro Annotations

Accession Description
IPR000086 NUDIX hydrolase domain
IPR015797 NUDIX hydrolase domain-like
IPR020084 NUDIX hydrolase, conserved site

UniProt Annotations

Entry Information

Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 3
Protein Entry
NUDT3_RAT
UniProt ID
Q566C7
Species
Rat

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=340 nM for PP-InsP5; KM=34 nM for [PP]2-InsP4;
Catalytic Activity Diphospho-myo-inositol polyphosphate + H(2)O = myo-inositol polyphosphate + phosphate
Cofactor Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence= ; Note=Binds 3 Mg(2+) ions per subunit. ;
Enzyme Regulation Inhibited by fluoride and InsP6
Function Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate) and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction. InsP6 (inositol hexakisphophate) is not a substrate. Acts as a negative regulator of the ERK1/2 pathway. Also able to catalyze the hydrolysis of dinucleoside oligophosphates, with Ap6A and Ap5A being the preferred substrates. The major reaction products are ADP and p4a from Ap6A and ADP and ATP from Ap5A. Also able to hydrolyze 5- phosphoribose 1-diphosphate
Similarity Belongs to the Nudix hydrolase family. DIPP subfamily
Similarity Contains 1 nudix hydrolase domain
Subcellular Location Cytoplasm .
Subunit Monomer

Identical and Related Proteins

Unique RefSeq proteins for LMP013117 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
66730447 RefSeq NP_001019414 168 diphosphoinositol polyphosphate phosphohydrolase 1

Identical Sequences to LMP013117 proteins

Reference Database Accession Length Protein Name
GI:66730447 GenBank AAH93618.1 168 Nudix (nucleoside diphosphate linked moiety X)-type motif 3 [Rattus norvegicus]
GI:66730447 GenBank EDL96893.1 168 nudix (nucleotide diphosphate linked moiety X)-type motif 3 [Rattus norvegicus]
GI:66730447 SwissProt Q566C7.1 168 RecName: Full=Diphosphoinositol polyphosphate phosphohydrolase 1; Short=DIPP-1; AltName: Full=Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 1; AltName: Full=Nucleoside diphosphate-linked moiety X motif 3; Short=Nudix motif 3 [Rattus norvegicus]

Related Sequences to LMP013117 proteins

Reference Database Accession Length Protein Name
GI:66730447 GenBank AAF74761.1 168 diphosphoinositol polyphosphate phosphohydrolase [Mus musculus]
GI:66730447 GenBank AAH93618.1 168 Nudix (nucleoside diphosphate linked moiety X)-type motif 3 [Rattus norvegicus]
GI:66730447 GenBank EDL96893.1 168 nudix (nucleotide diphosphate linked moiety X)-type motif 3 [Rattus norvegicus]
GI:66730447 SwissProt Q566C7.1 168 RecName: Full=Diphosphoinositol polyphosphate phosphohydrolase 1; Short=DIPP-1; AltName: Full=Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 1; AltName: Full=Nucleoside diphosphate-linked moiety X motif 3; Short=Nudix motif 3 [Rattus norvegicus]