Gene/Proteome Database (LMPD)
Proteins
| stAR-related lipid transfer protein 7, mitochondrial | |
|---|---|
| Refseq ID | NP_001099973 |
| Protein GI | 157824154 |
| UniProt ID | D3ZXY9 |
| mRNA ID | NM_001106503 |
| Length | 200 |
| MGRGEDPGGGVAELDTEYRKKWDALVIKLEVIERDAVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQENNVMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHTATLKAKNMEIKVKDYISAKPLEMSSEAKATASSPERKNEGSCGPARIEYA | |
Gene Information
Entrez Gene ID
Gene Name
StAR-related lipid transfer (START) domain containing 7
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0008289 | IEA:InterPro | F | lipid binding |
Domain Information
UniProt Annotations
Entry Information
Gene Name
StAR-related lipid transfer (START) domain containing 7
Protein Entry
D3ZXY9_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP013137 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 157824154 | RefSeq | NP_001099973 | 200 | stAR-related lipid transfer protein 7, mitochondrial |
Identical Sequences to LMP013137 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157824154 | GenBank | EDL80112.1 | 200 | START domain containing 7 (predicted) [Rattus norvegicus] |
Related Sequences to LMP013137 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157824154 | DBBJ | BAC38772.1 | 409 | unnamed protein product, partial [Mus musculus] |
| GI:157824154 | GenBank | AAH80747.1 | 295 | START domain containing 7 [Mus musculus] |
| GI:157824154 | GenBank | EDL80112.1 | 200 | START domain containing 7 (predicted) [Rattus norvegicus] |
| GI:157824154 | RefSeq | XP_006234979.1 | 373 | PREDICTED: stAR-related lipid transfer protein 7, mitochondrial isoform X1 [Rattus norvegicus] |