Gene/Proteome Database (LMPD)
Proteins
| group IID secretory phospholipase A2 precursor | |
|---|---|
| Refseq ID | NP_001013446 |
| Protein GI | 61740623 |
| UniProt ID | Q5BK35 |
| mRNA ID | NM_001013428 |
| Length | 144 |
| MRLALLCGLLLAGITATQGGLLNLNKMVNHMTGKKAFFSYWPYGCHCGFGGKGQPKDATDWCCQKHDCCYAHLKIDGCKSLTDNYKYSISEGVIQCSDQGSWCERQLCACDKEVALCLKQNLESYNKRLRYYWRPRCKGQTPTC | |
| sig_peptide: 1..19 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1915 peptide sequence: MRLALLCGLLLAGITATQG | |
Gene Information
Entrez Gene ID
Gene Name
phospholipase A2, group IID
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
| GO:0005509 | IEA:InterPro | F | calcium ion binding |
| GO:0004623 | IEA:InterPro | F | phospholipase A2 activity |
| GO:0016042 | IEA:InterPro | P | lipid catabolic process |
| GO:0006644 | IEA:InterPro | P | phospholipid metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00592 | alpha-Linolenic acid metabolism |
| rno00592 | alpha-Linolenic acid metabolism |
| ko00590 | Arachidonic acid metabolism |
| rno00590 | Arachidonic acid metabolism |
| ko00565 | Ether lipid metabolism |
| rno00565 | Ether lipid metabolism |
| ko04975 | Fat digestion and absorption |
| rno04975 | Fat digestion and absorption |
| ko00564 | Glycerophospholipid metabolism |
| rno00564 | Glycerophospholipid metabolism |
| ko00591 | Linoleic acid metabolism |
| rno00591 | Linoleic acid metabolism |
| rno01100 | Metabolic pathways |
| ko04972 | Pancreatic secretion |
| rno04972 | Pancreatic secretion |
| rno04014 | Ras signaling pathway |
| ko04270 | Vascular smooth muscle contraction |
| rno04270 | Vascular smooth muscle contraction |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5954464 | Acyl chain remodelling of PC |
| 5954471 | Acyl chain remodelling of PE |
| 5954465 | Acyl chain remodelling of PG |
| 5954468 | Acyl chain remodelling of PI |
| 5954470 | Acyl chain remodelling of PS |
| 5953473 | Glycerophospholipid biosynthesis |
| 5953250 | Metabolism |
| 5953289 | Metabolism of lipids and lipoproteins |
| 5953474 | Phospholipid metabolism |
| 5953472 | Synthesis of PA |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Phosphatidylcholine + H(2)O = 1- acylglycerophosphocholine + a carboxylate |
| Cofactor | Note=Binds 1 calcium ion per subunit. ; |
| Similarity | Belongs to the phospholipase A2 family |
| Subcellular Location | Secreted . |
Identical and Related Proteins
Unique RefSeq proteins for LMP013162 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 61740623 | RefSeq | NP_001013446 | 144 | group IID secretory phospholipase A2 precursor |
Identical Sequences to LMP013162 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:61740623 | GenBank | AAH91221.1 | 144 | Phospholipase A2, group IID [Rattus norvegicus] |
Related Sequences to LMP013162 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:61740623 | DBBJ | BAE42668.1 | 144 | unnamed protein product [Mus musculus] |
| GI:61740623 | DBBJ | BAE34473.1 | 144 | unnamed protein product [Mus musculus] |
| GI:61740623 | DBBJ | BAE34077.1 | 144 | unnamed protein product [Mus musculus] |
| GI:61740623 | GenBank | AAH91221.1 | 144 | Phospholipase A2, group IID [Rattus norvegicus] |