Gene/Proteome Database (LMPD)
LMPD ID
LMP013163
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
succinate dehydrogenase complex, subunit B, iron sulfur (Ip)
Gene Symbol
Alternate Names
succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial; ip; iron-sulfur subunit of complex II;
Chromosome
5
Map Location
5q36
EC Number
1.3.5.1
Proteins
succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial precursor | |
---|---|
Refseq ID | NP_001094009 |
Protein GI | 209915614 |
UniProt ID | P21913 |
mRNA ID | NM_001100539 |
Length | 282 |
MAAVVGVSLKRGFSATALGRVGLQFQACREAQTAAAAAPRIKTFAIYRWDPDKAGDKPRMQTYKVDLNKCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTDLGKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTEERLAKLQDPFSLYRCHTIMNCTQTCPKGLNPGKAIAEIKKMMATYKEKRALA | |
transit_peptide: 1..30 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (By similarity); propagated from UniProtKB/Swiss-Prot (P21913.2) calculated_mol_wt: 3124 peptide sequence: MAAVVGVSLKRGFSATALGRVGLQFQACRE mat_peptide: 31..282 product: Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P21913.2) calculated_mol_wt: 28724 peptide sequence: AQTAAAAAPRIKTFAIYRWDPDKAGDKPRMQTYKVDLNKCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTDLGKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTEERLAKLQDPFSLYRCHTIMNCTQTCPKGLNPGKAIAEIKKMMATYKEKRALA |
Gene Information
Entrez Gene ID
Gene Name
succinate dehydrogenase complex, subunit B, iron sulfur (Ip)
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0005743 | ISS:UniProtKB | C | mitochondrial inner membrane |
GO:0005749 | ISS:UniProtKB | C | mitochondrial respiratory chain complex II |
GO:0051537 | ISS:UniProtKB | F | 2 iron, 2 sulfur cluster binding |
GO:0051538 | ISS:UniProtKB | F | 3 iron, 4 sulfur cluster binding |
GO:0051539 | ISS:UniProtKB | F | 4 iron, 4 sulfur cluster binding |
GO:0009055 | IEA:InterPro | F | electron carrier activity |
GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
GO:0008177 | IMP:RGD | F | succinate dehydrogenase (ubiquinone) activity |
GO:0048039 | ISS:UniProtKB | F | ubiquinone binding |
GO:0022904 | IMP:RGD | P | respiratory electron transport chain |
GO:0006105 | IMP:RGD | P | succinate metabolic process |
GO:0006099 | IEA:UniProtKB-UniPathway | P | tricarboxylic acid cycle |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko05010 | Alzheimer's disease |
rno05010 | Alzheimer's disease |
ko01200 | Carbon metabolism |
rno01200 | Carbon metabolism |
ko00020 | Citrate cycle (TCA cycle) |
rno00020 | Citrate cycle (TCA cycle) |
M00009 | Citrate cycle (TCA cycle, Krebs cycle) |
M00011 | Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate |
ko05016 | Huntington's disease |
rno05016 | Huntington's disease |
rno01100 | Metabolic pathways |
ko04932 | Non-alcoholic fatty liver disease (NAFLD) |
rno04932 | Non-alcoholic fatty liver disease (NAFLD) |
ko00190 | Oxidative phosphorylation |
rno00190 | Oxidative phosphorylation |
rno05012 | Parkinson's disease |
M00148 | Succinate dehydrogenase (ubiquinone) |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5953285 | Citric acid cycle (TCA cycle) |
5953250 | Metabolism |
5953269 | Pyruvate metabolism and Citric Acid (TCA) cycle |
5953747 | Respiratory electron transport |
5953748 | Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. |
5953270 | The citric acid (TCA) cycle and respiratory electron transport |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR006058 | 2Fe-2S ferredoxin, iron-sulphur binding site |
IPR001041 | 2Fe-2S ferredoxin-type domain |
IPR017900 | 4Fe-4S ferredoxin, iron-sulphur binding, conserved site |
IPR017896 | 4Fe-4S ferredoxin-type, iron-sulphur binding domain |
IPR009051 | Alpha-helical ferredoxin |
IPR012675 | Beta-grasp domain |
IPR025192 | Succinate dehydogenase/fumarate reductase N-terminal |
IPR004489 | Succinate dehydrogenase/fumarate reductase iron-sulphur protein |
UniProt Annotations
Entry Information
Gene Name
succinate dehydrogenase complex, subunit B, iron sulfur (Ip)
Protein Entry
SDHB_RAT
UniProt ID
Species
Rat
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Succinate + a quinone = fumarate + a quinol. |
Cofactor | Name=[2Fe-2S] cluster; Xref=ChEBI:CHEBI:49601; Evidence= ; Note=Binds 1 [2Fe-2S] cluster. ; |
Cofactor | Name=[3Fe-4S] cluster; Xref=ChEBI:CHEBI:21137; Evidence= ; Note=Binds 1 [3Fe-4S] cluster. ; |
Cofactor | Name=[4Fe-4S] cluster; Xref=ChEBI:CHEBI:49883; Evidence= ; Note=Binds 1 [4Fe-4S] cluster. ; |
Function | Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q) |
Pathway | Carbohydrate metabolism; tricarboxylic acid cycle; fumarate from succinate (eukaryal route): step 1/1. |
Similarity | Belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family |
Similarity | Contains 1 2Fe-2S ferredoxin-type domain |
Similarity | Contains 1 4Fe-4S ferredoxin-type domain |
Subcellular Location | Mitochondrion inner membrane ; Peripheral membrane protein ; Matrix side . |
Subunit | Component of complex II composed of four subunits: the flavoprotein (FP) SDHA, iron-sulfur protein (IP) SDHB, and a cytochrome b560 composed of SDHC and SDHD |
Identical and Related Proteins
Unique RefSeq proteins for LMP013163 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
209915614 | RefSeq | NP_001094009 | 282 | succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial precursor |
Identical Sequences to LMP013163 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:209915614 | GenBank | EDL80954.1 | 282 | succinate dehydrogenase complex, subunit B, iron sulfur (Ip) (predicted), isoform CRA_d [Rattus norvegicus] |
GI:209915614 | GenBank | AAI58621.1 | 282 | Sdhb protein [Rattus norvegicus] |
GI:209915614 | SwissProt | P21913.2 | 282 | RecName: Full=Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial; AltName: Full=Iron-sulfur subunit of complex II; Short=Ip; Flags: Precursor [Rattus norvegicus] |
Related Sequences to LMP013163 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:209915614 | GenBank | EDL80954.1 | 282 | succinate dehydrogenase complex, subunit B, iron sulfur (Ip) (predicted), isoform CRA_d [Rattus norvegicus] |
GI:209915614 | GenBank | AAI58621.1 | 282 | Sdhb protein [Rattus norvegicus] |
GI:209915614 | RefSeq | XP_005352976.1 | 282 | PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial isoform X1 [Microtus ochrogaster] |
GI:209915614 | SwissProt | P21913.2 | 282 | RecName: Full=Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial; AltName: Full=Iron-sulfur subunit of complex II; Short=Ip; Flags: Precursor [Rattus norvegicus] |