Gene/Proteome Database (LMPD)
Proteins
all-trans retinoic acid-induced differentiation factor precursor | |
---|---|
Refseq ID | NP_001120998 |
Protein GI | 189011636 |
UniProt ID | B2RYU3 |
mRNA ID | NM_001127526 |
Length | 226 |
MASREPGSSVSPIPWAVTLLLVLGMERALALPEICTRCPGGVHNLSRVAAYCEDTSKLMQARCCLNQKGTILGLDLQNCSLKDPNLFPAYTAVIIDLQANPLKDDLTSTFHGFTQLQTLILPQDVHCPGGINAWDSVTSFMDKQICQGQKDLCNSTGSPEMCPENGSCASDGPGLLQCVCADGFHGYKCMRQGSFSLLMFFGILGSTTLAISILLWGTQRRKAKAS | |
sig_peptide: 1..30 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 3153 peptide sequence: MASREPGSSVSPIPWAVTLLLVLGMERALA |
Gene Information
Entrez Gene ID
Gene Name
all-trans retinoic acid-induced differentiation factor
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005635 | IEA:Ensembl | C | nuclear envelope |
GO:0048471 | IEA:Ensembl | C | perinuclear region of cytoplasm |
GO:2000599 | IEA:Ensembl | P | negative regulation of cyclin catabolic process |
GO:0033689 | IEA:Ensembl | P | negative regulation of osteoblast proliferation |
GO:0030501 | IEA:Ensembl | P | positive regulation of bone mineralization |
GO:0045669 | IEA:Ensembl | P | positive regulation of osteoblast differentiation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
all-trans retinoic acid-induced differentiation factor
Protein Entry
B2RYU3_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP013166 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
189011636 | RefSeq | NP_001120998 | 226 | all-trans retinoic acid-induced differentiation factor precursor |
Identical Sequences to LMP013166 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:189011636 | GenBank | EDM02941.1 | 226 | similar to apoptosis related protein APR-3; p18 protein (predicted), isoform CRA_b [Rattus norvegicus] |
GI:189011636 | GenBank | AAI66904.1 | 226 | RGD1311605 protein [Rattus norvegicus] |
Related Sequences to LMP013166 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:189011636 | GenBank | EDM02941.1 | 226 | similar to apoptosis related protein APR-3; p18 protein (predicted), isoform CRA_b [Rattus norvegicus] |
GI:189011636 | GenBank | EDM02943.1 | 202 | similar to apoptosis related protein APR-3; p18 protein (predicted), isoform CRA_d [Rattus norvegicus] |
GI:189011636 | GenBank | AAI66904.1 | 226 | RGD1311605 protein [Rattus norvegicus] |
GI:189011636 | RefSeq | XP_006995595.1 | 228 | PREDICTED: all-trans retinoic acid-induced differentiation factor [Peromyscus maniculatus bairdii] |