Gene/Proteome Database (LMPD)
LMPD ID
LMP013170
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
prostaglandin reductase 2
Gene Symbol
Synonyms
Zadh1;
Alternate Names
prostaglandin reductase 2; PRG-2 {ECO:0000250|UniProtKB:Q8VDQ1}; ptgr2 {ECO:0000250|UniProtKB:Q8VDQ1}; zinc binding alcohol dehydrogenase, domain containing 1; prostaglandin reductase 2 {ECO:0000250|UniProtKB:Q8VDQ1}; zinc-binding alcohol dehydrogenase domain-containing protein 1; 15-oxoprostaglandin 13-reductase {ECO:0000250|UniProtKB:Q8VDQ1};
Chromosome
6
Map Location
6q31
EC Number
1.3.1.48
Proteins
prostaglandin reductase 2 | |
---|---|
Refseq ID | NP_001015009 |
Protein GI | 62543513 |
UniProt ID | Q5BK81 |
mRNA ID | NM_001015009 |
Length | 281 |
MIIQRVVLDSRPGKNGNPVAENFRVEEVSLPDTINEGQVRVRTLYLSVDPYMRCKMNEETGADYLAPWQLAQVADGGGLGVIEESKHQKLAKGDFVTSFYWPWQTKAILDGNGLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGVQEKGHVSAGSNQTMVVSGAAGACGSLAGQIGHLLGCSRVVGICGTHEKCLFLTSELGFDAAVNYKTGNVAEQLREACPDGVDVYFDNVGGDISNAVISQIKETVANGLENMGVAFQSMMTGGNIGKQIVRISEDSSP |
Gene Information
Entrez Gene ID
Gene Name
prostaglandin reductase 2
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
GO:0036132 | IEA:UniProtKB-EC | F | 13-prostaglandin reductase activity |
GO:0047522 | ISS:UniProtKB | F | 15-oxoprostaglandin 13-oxidase activity |
GO:0006693 | ISS:UniProtKB | P | prostaglandin metabolic process |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1 ; IsoId=Q5BK81-1; Sequence=Displayed; Note=Gene prediction based on similarity to mouse ortholog. ; Name=2 ; IsoId=Q5BK81-2; Sequence=VSP_052852; Note=No experimental confirmation available. ; |
Catalytic Activity | 11-alpha-hydroxy-9,15-dioxoprost-5-enoate + NAD(P)(+) = (5Z)-(13E)-11-alpha-hydroxy-9,15-dioxoprosta-5,13- dienoate + NAD(P)H |
Function | Functions as 15-oxo-prostaglandin 13-reductase and acts on 15-keto-PGE1, 15-keto-PGE2, 15-keto-PGE1-alpha and 15-keto- PGE2-alpha with highest activity towards 15-keto-PGE2. Overexpression represses transcriptional activity of PPARG and inhibits adipocyte differentiation (By similarity) |
Similarity | Belongs to the NADP-dependent oxidoreductase L4BD family |
Subcellular Location | Cytoplasm . |
Subunit | Monomer |
Identical and Related Proteins
Unique RefSeq proteins for LMP013170 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
62543513 | RefSeq | NP_001015009 | 281 | prostaglandin reductase 2 |
Identical Sequences to LMP013170 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:62543513 | GenBank | AAH91173.1 | 281 | Prostaglandin reductase 2 [Rattus norvegicus] |
Related Sequences to LMP013170 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:62543513 | GenBank | AAH91173.1 | 281 | Prostaglandin reductase 2 [Rattus norvegicus] |
GI:62543513 | GenBank | EDL81483.1 | 351 | zinc binding alcohol dehydrogenase, domain containing 1, isoform CRA_b [Rattus norvegicus] |
GI:62543513 | RefSeq | XP_006240388.1 | 351 | PREDICTED: prostaglandin reductase 2 isoform X1 [Rattus norvegicus] |
GI:62543513 | RefSeq | XP_006240389.1 | 351 | PREDICTED: prostaglandin reductase 2 isoform X1 [Rattus norvegicus] |