Gene/Proteome Database (LMPD)

LMPD ID
LMP013172
Gene ID
299201
Species
Rattus norvegicus (Rat)
Gene Name
dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
Gene Symbol
Dlst
Alternate Names
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial; E2; E2K; OGDC-E2; 2-oxoglutarate dehydrogenase complex component E2; dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex;
Chromosome
6
Map Location
6q31
EC Number
2.3.1.61

Proteins

dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial
Refseq ID NP_001006982
Protein GI 195927000
UniProt ID Q01205
mRNA ID NM_001006981
Length 454
MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPDSRKMVINNSSVFSVRFFQTTAVCKNDVITVQTPAFAESVTEGDVRWEKAVGDAVAEDEVVCEIETDKTSVQVPSPANGIIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPATAHKAAPEAPAAPPPPVAPVPTQMPPVPSPSQPPSSKPVSAIKPTAAPPLAEAGAAKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEVDMSNIQEMRARHKDAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDATKEVVYRDYIDISVAVATPRGLVVPVIRNVETMNYADIERTINELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAVGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
transit_peptide: 1..68 experiment: experimental evidence, no additional details recorded note: Mitochondrion; propagated from UniProtKB/Swiss-Prot (Q01205.2) calculated_mol_wt: 7476 peptide sequence: MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPDSRKMVINNSSVFSVRFFQTTAVCK mat_peptide: 69..454 product: Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q01205.2) calculated_mol_wt: 41442 peptide sequence: NDVITVQTPAFAESVTEGDVRWEKAVGDAVAEDEVVCEIETDKTSVQVPSPANGIIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPATAHKAAPEAPAAPPPPVAPVPTQMPPVPSPSQPPSSKPVSAIKPTAAPPLAEAGAAKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEVDMSNIQEMRARHKDAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDATKEVVYRDYIDISVAVATPRGLVVPVIRNVETMNYADIERTINELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAVGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL

Gene Information

Entrez Gene ID
299201
Gene Name
dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
Gene Symbol
Dlst
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0043231 IDA:RGD C intracellular membrane-bounded organelle
GO:0005739 IDA:RGD C mitochondrion
GO:0045252 IDA:RGD C oxoglutarate dehydrogenase complex
GO:0005886 IDA:RGD C plasma membrane
GO:0051087 IPI:RGD F chaperone binding
GO:0004149 IDA:RGD F dihydrolipoyllysine-residue succinyltransferase activity
GO:0031072 IPI:RGD F heat shock protein binding
GO:0006103 IDA:RGD P 2-oxoglutarate metabolic process
GO:0033512 IEA:UniProtKB-UniPathway P L-lysine catabolic process to acetyl-CoA via saccharopine
GO:0006734 IDA:RGD P NADH metabolic process
GO:0006099 IC:RGD P tricarboxylic acid cycle

KEGG Pathway Links

KEGG Pathway ID Description
ko01200 Carbon metabolism
rno01200 Carbon metabolism
ko00020 Citrate cycle (TCA cycle)
rno00020 Citrate cycle (TCA cycle)
M00009 Citrate cycle (TCA cycle, Krebs cycle)
M00011 Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ko00310 Lysine degradation
rno00310 Lysine degradation
M00032 Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
rno01100 Metabolic pathways

REACTOME Pathway Links

REACTOME Pathway ID Description
5953285 Citric acid cycle (TCA cycle)
5953284 Lysine catabolism
5953250 Metabolism
5953272 Metabolism of amino acids and derivatives
5953269 Pyruvate metabolism and Citric Acid (TCA) cycle
5953270 The citric acid (TCA) cycle and respiratory electron transport

Domain Information

InterPro Annotations

Accession Description
IPR003016 2-oxo acid dehydrogenase, lipoyl-binding site
IPR001078 2-oxoacid dehydrogenase acyltransferase, catalytic domain
IPR000089 Biotin/lipoyl attachment
IPR023213 Chloramphenicol acetyltransferase-like domain
IPR006255 Dihydrolipoamide succinyltransferase
IPR011053 Single hybrid motif

UniProt Annotations

Entry Information

Gene Name
dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
Protein Entry
ODO2_RAT
UniProt ID
Q01205
Species
Rat

Comments

Comment Type Description
Catalytic Activity Succinyl-CoA + enzyme N(6)- (dihydrolipoyl)lysine = CoA + enzyme N(6)-(S- succinyldihydrolipoyl)lysine.
Cofactor Name=(R)-lipoate; Xref=ChEBI:CHEBI:83088; Note=Binds 1 lipoyl cofactor covalently.;
Function The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). It contains multiple copies of 3 enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3).
Pathway Amino-acid degradation; L-lysine degradation via saccharopine pathway; glutaryl-CoA from L-lysine: step 6/6.
Similarity Belongs to the 2-oxoacid dehydrogenase family
Similarity Contains 1 lipoyl-binding domain
Subcellular Location Mitochondrion.
Subunit Forms a 24-polypeptide structural core with octahedral symmetry.

Identical and Related Proteins

Unique RefSeq proteins for LMP013172 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
195927000 RefSeq NP_001006982 454 dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial

Identical Sequences to LMP013172 proteins

Reference Database Accession Length Protein Name
GI:195927000 GenBank EDL81544.1 454 dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex), isoform CRA_a [Rattus norvegicus]
GI:195927000 GenBank EDL81545.1 454 dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex), isoform CRA_a [Rattus norvegicus]
GI:195927000 GenBank EDL81546.1 454 dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex), isoform CRA_a [Rattus norvegicus]

Related Sequences to LMP013172 proteins

Reference Database Accession Length Protein Name
GI:195927000 GenBank AAH83858.1 454 Dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) [Rattus norvegicus]
GI:195927000 GenBank EDL81544.1 454 dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex), isoform CRA_a [Rattus norvegicus]
GI:195927000 GenBank EDL81545.1 454 dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex), isoform CRA_a [Rattus norvegicus]
GI:195927000 GenBank EDL81546.1 454 dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex), isoform CRA_a [Rattus norvegicus]