Gene/Proteome Database (LMPD)

LMPD ID
LMP013173
Gene ID
299210
Species
Rattus norvegicus (Rat)
Gene Name
estrogen-related receptor beta
Gene Symbol
Esrrb
Synonyms
Err2; Errb;
Alternate Names
steroid hormone receptor ERR2; ERR-beta; estrogen receptor-like 2; estrogen-related receptor, beta; nuclear receptor subfamily 3 group B member 2;
Chromosome
6
Map Location
6q31

Proteins

steroid hormone receptor ERR2
Refseq ID NP_001008516
Protein GI 82524848
UniProt ID P11475
mRNA ID NM_001008516
Length 433
MSSEDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGMALGTHANGLDSPPMFAGAGLGGNPCRKSYEDCTSGIMEDSAIKCEYMLNAIPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRLDSENSPYLSLQISPPAKKPLTKIVSYLLVAEPDKLYAMPPDDVPEGDIKALTTLCDLADRELVFLISWAKHIPGFSNLTLGDQMSLLQSAWMEILILGIVYRSLPYDDKLAYAEDYIMDEEHSRLVGLLELYRAILQLVRRYKKLKVEKEEFVMLKALALANSDSMYIENLEAVQKLQDLLHEALQDYELSQRHEEPRRAGKLLLTLPLLRQTAAKAVQHFYSVKLQGKVPMHKLFLEMLEAKV

Gene Information

Entrez Gene ID
299210
Gene Name
estrogen-related receptor beta
Gene Symbol
Esrrb
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005634 IEA:UniProtKB-KW C nucleus
GO:0000980 IEA:Ensembl F RNA polymerase II distal enhancer sequence-specific DNA binding
GO:0043565 ISS:UniProtKB F sequence-specific DNA binding
GO:0003700 IEA:InterPro F sequence-specific DNA binding transcription factor activity
GO:0005496 IEA:InterPro F steroid binding
GO:0003707 IEA:InterPro F steroid hormone receptor activity
GO:0003713 IEA:Ensembl F transcription coactivator activity
GO:0008270 IEA:InterPro F zinc ion binding
GO:0001892 IEA:Ensembl P embryonic placenta development
GO:0045944 IEA:Ensembl P positive regulation of transcription from RNA polymerase II promoter
GO:0006355 ISS:UniProtKB P regulation of transcription, DNA-templated
GO:0019827 IEA:Ensembl P stem cell maintenance
GO:0006351 IEA:UniProtKB-KW P transcription, DNA-templated
GO:0001834 IEA:Ensembl P trophectodermal cell proliferation
GO:0001831 IEA:Ensembl P trophectodermal cellular morphogenesis

KEGG Pathway Links

KEGG Pathway ID Description
ko04550 Signaling pathways regulating pluripotency of stem cells
rno04550 Signaling pathways regulating pluripotency of stem cells

REACTOME Pathway Links

REACTOME Pathway ID Description
5953330 Gene Expression
5953833 Generic Transcription Pathway
5954147 Nuclear Receptor transcription pathway

Domain Information

InterPro Annotations

Accession Description
IPR008946 Nuclear hormone receptor, ligand-binding
IPR000536 Nuclear hormone receptor, ligand-binding, core
IPR024178 Oestrogen receptor/oestrogen-related receptor
IPR027289 Oestrogen-related receptor
IPR001723 Steroid hormone receptor
IPR013088 Zinc finger, NHR/GATA-type
IPR001628 Zinc finger, nuclear hormone receptor-type

UniProt Annotations

Entry Information

Gene Name
estrogen-related receptor beta
Protein Entry
ERR2_RAT
UniProt ID
P11475
Species
Rat

Comments

Comment Type Description
Caution Was originally (PubMed:3267207) thought to originate from human but was later shown (PubMed:10072763) to be derived from rat
Function Nuclear receptor, may regulate ESR1 transcriptional activity. Induces the expression of PERM1 in the skeletal muscle (By similarity)
Ptm Acetylated by PCAF/KAT2 (in vitro)
Similarity Belongs to the nuclear hormone receptor family. NR3 subfamily
Similarity Contains 1 nuclear receptor DNA-binding domain
Subcellular Location Nucleus {ECO:0000255|PROSITE- ProRule:PRU00407}.
Subunit Binds DNA as a monomer

Identical and Related Proteins

Unique RefSeq proteins for LMP013173 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
82524848 RefSeq NP_001008516 433 steroid hormone receptor ERR2

Identical Sequences to LMP013173 proteins

Reference Database Accession Length Protein Name
GI:82524848 GenBank AAR89824.1 433 estrogen receptor-related receptor beta [Rattus norvegicus]
GI:82524848 pat WO 433 Sequence 14 from Patent WO 8803168
GI:82524848 PRF - 433 cryptic steroid hormone receptor 2 [Homo sapiens]
GI:82524848 SwissProt P11475.1 433 RecName: Full=Steroid hormone receptor ERR2; AltName: Full=Estrogen receptor-like 2; AltName: Full=Estrogen-related receptor beta; Short=ERR-beta; AltName: Full=Nuclear receptor subfamily 3 group B member 2 [Rattus norvegicus]

Related Sequences to LMP013173 proteins

Reference Database Accession Length Protein Name
GI:82524848 EMBL CAA35779.1 433 unnamed protein product [Homo sapiens]
GI:82524848 PIR - 433 steroid hormone receptor ERR2 precursor - human [Homo sapiens]
GI:82524848 PRF - 433 cryptic steroid hormone receptor 2 [Homo sapiens]
GI:82524848 SwissProt P11475.1 433 RecName: Full=Steroid hormone receptor ERR2; AltName: Full=Estrogen receptor-like 2; AltName: Full=Estrogen-related receptor beta; Short=ERR-beta; AltName: Full=Nuclear receptor subfamily 3 group B member 2 [Rattus norvegicus]