Gene/Proteome Database (LMPD)
LMPD ID
LMP013183
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1
Gene Symbol
Synonyms
RGD1564237;
Alternate Names
glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1; GPI-anchored HDL-binding protein 1;
Chromosome
7
Map Location
7q34
Proteins
glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 precursor | |
---|---|
Refseq ID | NP_001124019 |
Protein GI | 194474096 |
UniProt ID | D3ZZL5 |
mRNA ID | NM_001130547 |
Length | 236 |
MKALRAVLLILLLSGQPGSSWAQEAGDVDLELERYSYDDDGDDDDDDDEEEEEEETNMIPGSRDRAPPLQCYFCQVLHSGESCNETQSCSSSKPFCITVISHGKTDTGVLTTYSMWCTDTCQPIVKTVDSTQMTQTCCQSTLCNIPPWQSPQIHNPLGGRADSPLKGGTRHPQGDRFSHPQVVKVTHPQSDGAHLSKGGKANQPQGNGAGFPAGWSKFGNVVLLLTFLTSLWASGA | |
sig_peptide: 1..22 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2325 peptide sequence: MKALRAVLLILLLSGQPGSSWA |
Gene Information
Entrez Gene ID
Gene Name
glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0046658 | IEA:Ensembl | C | anchored component of plasma membrane |
GO:0016324 | IEA:Ensembl | C | apical plasma membrane |
GO:0016323 | IEA:Ensembl | C | basolateral plasma membrane |
GO:0009897 | IEA:Ensembl | C | external side of plasma membrane |
GO:0035478 | IEA:Ensembl | F | chylomicron binding |
GO:0008035 | IEA:Ensembl | F | high-density lipoprotein particle binding |
GO:0008320 | IEA:Ensembl | F | protein transmembrane transporter activity |
GO:0042632 | IEA:Ensembl | P | cholesterol homeostasis |
GO:0006886 | IEA:Ensembl | P | intracellular protein transport |
GO:0006869 | IEA:Ensembl | P | lipid transport |
GO:0090321 | IEA:Ensembl | P | positive regulation of chylomicron remnant clearance |
GO:0051006 | IEA:Ensembl | P | positive regulation of lipoprotein lipase activity |
GO:0017038 | IEA:Ensembl | P | protein import |
GO:0034394 | IEA:Ensembl | P | protein localization to cell surface |
GO:0050821 | IEA:Ensembl | P | protein stabilization |
GO:0045056 | IEA:Ensembl | P | transcytosis |
GO:0070328 | IEA:Ensembl | P | triglyceride homeostasis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1
Protein Entry
D3ZZL5_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP013183 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
194474096 | RefSeq | NP_001124019 | 236 | glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 precursor |
Identical Sequences to LMP013183 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:194474096 | GenBank | EDM16060.1 | 236 | similar to high density lipoprotein-binding protein (predicted), isoform CRA_a [Rattus norvegicus] |
Related Sequences to LMP013183 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:194474096 | EMBL | CAC37739.1 | 236 | unnamed protein product [Rattus norvegicus] |
GI:194474096 | GenBank | AAW06790.1 | 236 | Sequence 6 from patent US 6800455 |
GI:194474096 | GenBank | EDM16060.1 | 236 | similar to high density lipoprotein-binding protein (predicted), isoform CRA_a [Rattus norvegicus] |
GI:194474096 | GenBank | ABS94084.1 | 236 | Sequence 6 from patent US 7202344 |