Gene/Proteome Database (LMPD)

LMPD ID
LMP013183
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1
Gene Symbol
Synonyms
RGD1564237;
Alternate Names
glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1; GPI-anchored HDL-binding protein 1;
Chromosome
7
Map Location
7q34

Proteins

glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 precursor
Refseq ID NP_001124019
Protein GI 194474096
UniProt ID D3ZZL5
mRNA ID NM_001130547
Length 236
MKALRAVLLILLLSGQPGSSWAQEAGDVDLELERYSYDDDGDDDDDDDEEEEEEETNMIPGSRDRAPPLQCYFCQVLHSGESCNETQSCSSSKPFCITVISHGKTDTGVLTTYSMWCTDTCQPIVKTVDSTQMTQTCCQSTLCNIPPWQSPQIHNPLGGRADSPLKGGTRHPQGDRFSHPQVVKVTHPQSDGAHLSKGGKANQPQGNGAGFPAGWSKFGNVVLLLTFLTSLWASGA
sig_peptide: 1..22 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2325 peptide sequence: MKALRAVLLILLLSGQPGSSWA

Gene Information

Entrez Gene ID
Gene Name
glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0046658 IEA:Ensembl C anchored component of plasma membrane
GO:0016324 IEA:Ensembl C apical plasma membrane
GO:0016323 IEA:Ensembl C basolateral plasma membrane
GO:0009897 IEA:Ensembl C external side of plasma membrane
GO:0035478 IEA:Ensembl F chylomicron binding
GO:0008035 IEA:Ensembl F high-density lipoprotein particle binding
GO:0008320 IEA:Ensembl F protein transmembrane transporter activity
GO:0042632 IEA:Ensembl P cholesterol homeostasis
GO:0006886 IEA:Ensembl P intracellular protein transport
GO:0006869 IEA:Ensembl P lipid transport
GO:0090321 IEA:Ensembl P positive regulation of chylomicron remnant clearance
GO:0051006 IEA:Ensembl P positive regulation of lipoprotein lipase activity
GO:0017038 IEA:Ensembl P protein import
GO:0034394 IEA:Ensembl P protein localization to cell surface
GO:0050821 IEA:Ensembl P protein stabilization
GO:0045056 IEA:Ensembl P transcytosis
GO:0070328 IEA:Ensembl P triglyceride homeostasis

Domain Information

InterPro Annotations

Accession Description
IPR001526 CD59 antigen
IPR018363 CD59 antigen, conserved site
IPR016054 Ly-6 antigen / uPA receptor -like

UniProt Annotations

Entry Information

Gene Name
glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1
Protein Entry
D3ZZL5_RAT
UniProt ID
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP013183 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
194474096 RefSeq NP_001124019 236 glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 precursor

Identical Sequences to LMP013183 proteins

Reference Database Accession Length Protein Name
GI:194474096 GenBank EDM16060.1 236 similar to high density lipoprotein-binding protein (predicted), isoform CRA_a [Rattus norvegicus]

Related Sequences to LMP013183 proteins

Reference Database Accession Length Protein Name
GI:194474096 EMBL CAC37739.1 236 unnamed protein product [Rattus norvegicus]
GI:194474096 GenBank AAW06790.1 236 Sequence 6 from patent US 6800455
GI:194474096 GenBank EDM16060.1 236 similar to high density lipoprotein-binding protein (predicted), isoform CRA_a [Rattus norvegicus]
GI:194474096 GenBank ABS94084.1 236 Sequence 6 from patent US 7202344