Gene/Proteome Database (LMPD)
LMPD ID
LMP013188
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
ALG13, UDP-N-acetylglucosaminyltransferase subunit
Gene Symbol
Alternate Names
UDP-N-acetylglucosamine transferase subunit ALG13 homolog; asparagine-linked glycosylation 13 homolog; glycosyltransferase 28 domain-containing protein 1;
Chromosome
X
Map Location
Xq14
EC Number
2.4.1.141
Proteins
| UDP-N-acetylglucosamine transferase subunit ALG13 homolog | |
|---|---|
| Refseq ID | NP_001013973 |
| Protein GI | 62078631 |
| UniProt ID | Q5I0K7 |
| mRNA ID | NM_001013951 |
| Length | 165 |
| MKRAFVTVGTTSFDDLVARVVANDTVQILKSLGYNHLVLQIGRGTVVPEPFSTEPFTLDVYRYKESLKEDLQQADLVISHAGAGSCLESLEKGKPLVVVVNEKLMNNHQFELAKQLHKEGHLFYCTCSMLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGLQK | |
Gene Information
Entrez Gene ID
Gene Name
ALG13, UDP-N-acetylglucosaminyltransferase subunit
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0004577 | IEA:UniProtKB-EC | F | N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase activity |
| GO:0030246 | IEA:InterPro | F | carbohydrate binding |
| GO:0030259 | IEA:InterPro | P | lipid glycosylation |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR007235 | Glycosyl transferase, family 28, C-terminal |
UniProt Annotations
Entry Information
Gene Name
ALG13, UDP-N-acetylglucosaminyltransferase subunit
Protein Entry
ALG13_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | UDP-N-acetyl-D-glucosamine + N-acetyl-D- glucosaminyl-diphosphodolichol = UDP + N,N'-diacetylchitobiosyl- diphosphodolichol. |
| Function | May be involved in protein N-glycosylation, second step of the dolichol-linked oligosaccharide pathway |
| Similarity | Belongs to the glycosyltransferase 28 family |
| Subcellular Location | Endoplasmic reticulum . Note=Could be recruited to the cytosolic face of the endoplasmic reticulum membrane through its interaction with ALG14 |
| Subunit | May interact with ALG14 |
Identical and Related Proteins
Unique RefSeq proteins for LMP013188 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 62078631 | RefSeq | NP_001013973 | 165 | UDP-N-acetylglucosamine transferase subunit ALG13 homolog |
Identical Sequences to LMP013188 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:62078631 | GenBank | AAH88233.1 | 165 | Asparagine-linked glycosylation 13 homolog (S. cerevisiae) [Rattus norvegicus] |
| GI:62078631 | GenBank | EDL85188.1 | 165 | rCG23145, isoform CRA_b [Rattus norvegicus] |
| GI:62078631 | SwissProt | Q5I0K7.1 | 165 | RecName: Full=UDP-N-acetylglucosamine transferase subunit ALG13 homolog; AltName: Full=Glycosyltransferase 28 domain-containing protein 1 [Rattus norvegicus] |
Related Sequences to LMP013188 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:62078631 | DBBJ | BAC40750.1 | 165 | unnamed protein product [Mus musculus] |
| GI:62078631 | GenBank | AAH88233.1 | 165 | Asparagine-linked glycosylation 13 homolog (S. cerevisiae) [Rattus norvegicus] |
| GI:62078631 | GenBank | EDL85188.1 | 165 | rCG23145, isoform CRA_b [Rattus norvegicus] |
| GI:62078631 | SwissProt | Q5I0K7.1 | 165 | RecName: Full=UDP-N-acetylglucosamine transferase subunit ALG13 homolog; AltName: Full=Glycosyltransferase 28 domain-containing protein 1 [Rattus norvegicus] |