Gene/Proteome Database (LMPD)
LMPD ID
LMP013206
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
3-hydroxyisobutyryl-CoA hydrolase
Gene Symbol
Alternate Names
3-hydroxyisobutyryl-CoA hydrolase, mitochondrial; HIBYL-CoA-H; HIB-CoA hydrolase; 3-hydroxyisobutyryl-Coenzyme A hydrolase;
Chromosome
9
Map Location
9q22
EC Number
3.1.2.4
Proteins
| 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial | |
|---|---|
| Refseq ID | NP_001013130 |
| Protein GI | 61556993 |
| UniProt ID | Q5XIE6 |
| mRNA ID | NM_001013112 |
| Length | 311 |
| MGQQFVWRLQSRFSSIRRASVILQHLRMSKHTETAEVLLERRGCAGVITLNRPKLLNALSLNMIRQIYPQLKKWERDPDTFLIIIKGAGGKAFCAGGDIKALSEAKKAGQTLSQDLFREEYILNNAIASCQKPYVALIDGITMGGGVGLSVHGQFRVATERSLFAMPETGIGLFPDVGGGYFLPRLQGKLGYFLALTGFRLKGRDVHRAGIATHFVDSEKLHVLEEELLALKSPSAEDVAGVLESYHAKSKMGQDKSIIFEEHMDKINSCFSANTVEQILENLRQDGSPFAMEQIKFSLTKTRLQNGNQLI | |
| transit_peptide: 1..32 experiment: experimental evidence, no additional details recorded note: Mitochondrion; propagated from UniProtKB/Swiss-Prot (Q5XIE6.2) calculated_mol_wt: 3886 peptide sequence: MGQQFVWRLQSRFSSIRRASVILQHLRMSKHT | |
Gene Information
Entrez Gene ID
Gene Name
3-hydroxyisobutyryl-CoA hydrolase
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0005739 | IEA:UniProtKB-KW | C | mitochondrion |
| GO:0003860 | IEA:UniProtKB-EC | F | 3-hydroxyisobutyryl-CoA hydrolase activity |
| GO:0006574 | IEA:UniProtKB-UniPathway | P | valine catabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko01200 | Carbon metabolism |
| rno01200 | Carbon metabolism |
| M00013 | Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA |
| rno01100 | Metabolic pathways |
| ko00640 | Propanoate metabolism |
| rno00640 | Propanoate metabolism |
| ko00280 | Valine, leucine and isoleucine degradation |
| rno00280 | Valine, leucine and isoleucine degradation |
| ko00410 | beta-Alanine metabolism |
| rno00410 | beta-Alanine metabolism |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| VALDEG-PWY | valine degradation I |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q5XIE6-1; Sequence=Displayed; Name=2; IsoId=Q5XIE6-2; Sequence=VSP_024781, VSP_024782; Note=No experimental confirmation available.; |
| Biophysicochemical Properties | Kinetic parameters: KM=6 uM for 3-hydroxyisobutyryl-CoA ; KM=25 uM for 3-hydroxypropionyl-CoA ; Vmax=443 umol/min/mg enzyme with 3-hydroxyisobutyryl-CoA as substrate ; Vmax=250 umol/min/mg enzyme with 3-hydroxypropionyl-CoA as substrate ; pH dependence: Optimum pH is 7-9 with 3-hydroxyisobutyryl-CoA as substrate and 6 with 3-hydroxypropionyl-CoA as substrate. ; |
| Catalytic Activity | 3-hydroxy-2-methylpropanoyl-CoA + H(2)O = CoA + 3-hydroxy-2-methylpropanoate |
| Function | Hydrolyzes 3-hydroxyisobutyryl-CoA (HIBYL-CoA), a saline catabolite. Has high activity toward isobutyryl-CoA. Could be an isobutyryl-CoA dehydrogenase that functions in valine catabolism. Also hydrolyzes 3-hydroxypropanoyl-CoA (By similarity) |
| Pathway | Amino-acid degradation; L-valine degradation. |
| Similarity | Belongs to the enoyl-CoA hydratase/isomerase family |
| Subcellular Location | Mitochondrion . |
| Tissue Specificity | Highest activity in liver, kidney and heart. Low activity in muscle and brain |
Identical and Related Proteins
Unique RefSeq proteins for LMP013206 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 61556993 | RefSeq | NP_001013130 | 311 | 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial |
Identical Sequences to LMP013206 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:61556993 | GenBank | AAH83737.1 | 311 | 3-hydroxyisobutyryl-Coenzyme A hydrolase [Rattus norvegicus] |
Related Sequences to LMP013206 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:61556993 | GenBank | AAH83737.1 | 311 | 3-hydroxyisobutyryl-Coenzyme A hydrolase [Rattus norvegicus] |
| GI:61556993 | GenBank | EDL99105.1 | 385 | 3-hydroxyisobutyryl-Coenzyme A hydrolase [Rattus norvegicus] |
| GI:61556993 | RefSeq | XP_006244957.1 | 385 | PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial isoform X1 [Rattus norvegicus] |
| GI:61556993 | SwissProt | Q5XIE6.2 | 385 | RecName: Full=3-hydroxyisobutyryl-CoA hydrolase, mitochondrial; AltName: Full=3-hydroxyisobutyryl-coenzyme A hydrolase; Short=HIB-CoA hydrolase; Short=HIBYL-CoA-H; Flags: Precursor [Rattus norvegicus] |