Gene/Proteome Database (LMPD)

LMPD ID
LMP013237
Gene ID
303923
Species
Rattus norvegicus (Rat)
Gene Name
UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 4
Gene Symbol
B4galt4
Alternate Names
beta-1,4-galactosyltransferase 4; b4Gal-T4; beta4Gal-T4; beta-1,4-GalTase 4; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 4; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 4;
Chromosome
11
Map Location
11q21
EC Number
2.4.1.-

Proteins

beta-1,4-galactosyltransferase 4
Refseq ID NP_001012018
Protein GI 58865614
UniProt ID Q66HH1
mRNA ID NM_001012018
Length 344
MGCNPPYLLSYRLRLLLLFTLCLTVLGWATSNYFVGAIQVIPRAKNFMATLHKVMYLGNEETLGHGAAMKKAELANCPSVSPNLRGQNKLVFKPDLTLEEVQAKNPKVSRGRYRPEECKALQRVAVLIPHRNREKHLIYLLEHLHPFLQRQQLDYGIYVIHQTGSKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYTCGDQPKHLVVGRNSTGYRLRYSKYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELHKMKISRPKPDVGKYTMIFHTRDKGNEVNGSRMKLLQQMSRVWKTDGLSSCSYRLLSVEHNPLYANITVDFWTAA

Gene Information

Entrez Gene ID
303923
Gene Name
UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 4
Gene Symbol
B4galt4
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IEA:UniProtKB-KW C Golgi apparatus
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0003945 IEA:UniProtKB-EC F N-acetyllactosamine synthase activity
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0006486 IEA:UniProtKB-UniPathway P protein glycosylation

KEGG Pathway Links

KEGG Pathway ID Description
ko00533 Glycosaminoglycan biosynthesis - keratan sulfate
rno00533 Glycosaminoglycan biosynthesis - keratan sulfate
ko00601 Glycosphingolipid biosynthesis - lacto and neolacto series
rno00601 Glycosphingolipid biosynthesis - lacto and neolacto series
M00071 Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
rno01100 Metabolic pathways

REACTOME Pathway Links

REACTOME Pathway ID Description
5953739 Asparagine N-linked glycosylation
5953253 Disease
5953252 Glycogen storage diseases
5953861 Glycosaminoglycan metabolism
5954344 Keratan sulfate biosynthesis
5954345 Keratan sulfate/keratin metabolism
5953870 MPS I - Hurler syndrome
5953869 MPS II - Hunter syndrome
5953872 MPS IIIA - Sanfilippo syndrome A
5953864 MPS IIIB - Sanfilippo syndrome B
5953867 MPS IIIC - Sanfilippo syndrome C
5953871 MPS IIID - Sanfilippo syndrome D
5953866 MPS IV - Morquio syndrome A
5953873 MPS IV - Morquio syndrome B
5953862 MPS IX - Natowicz syndrome
5953865 MPS VI - Maroteaux-Lamy syndrome
5953868 MPS VII - Sly syndrome
5953250 Metabolism
5953249 Metabolism of carbohydrates
5953345 Metabolism of proteins
5953863 Mucopolysaccharidoses
5953251 Myoclonic epilepsy of Lafora
5954395 N-Glycan antennae elongation
5954394 N-glycan antennae elongation in the medial/trans-Golgi
5953728 Post-translational protein modification
5954050 Transport to the Golgi and subsequent modification

Domain Information

InterPro Annotations

Accession Description
IPR003859 Beta-1,4-galactosyltransferase
IPR027791 Galactosyltransferase, C-terminal
IPR027995 Galactosyltransferase, N-terminal
IPR029044 Nucleotide-diphospho-sugar transferases

UniProt Annotations

Entry Information

Gene Name
UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 4
Protein Entry
B4GT4_RAT
UniProt ID
Q66HH1
Species
Rat

Comments

Comment Type Description
Catalytic Activity UDP-alpha-D-galactose + N-acetyl-D-glucosamine = UDP + N-acetyllactosamine.
Catalytic Activity UDP-alpha-D-galactose + N-acetyl-beta-D- glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl- (1<->1)-ceramide = UDP + beta-D-galactosyl-(1->4)-N-acetyl-beta-D- glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl- (1<->1)-ceramide.
Cofactor Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence= ;
Function Responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the glycosyltransferase 7 family
Subcellular Location Golgi apparatus, Golgi stack membrane {ECO:0000250}; Single-pass type II membrane protein . Note=Trans cisternae of Golgi stack

Identical and Related Proteins

Unique RefSeq proteins for LMP013237 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
58865614 RefSeq NP_001012018 344 beta-1,4-galactosyltransferase 4

Identical Sequences to LMP013237 proteins

Reference Database Accession Length Protein Name
GI:58865614 GenBank AAH81866.1 344 UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 4 [Rattus norvegicus]
GI:58865614 GenBank EDM11208.1 344 rCG52599, isoform CRA_a [Rattus norvegicus]
GI:58865614 GenBank EDM11209.1 344 rCG52599, isoform CRA_a [Rattus norvegicus]
GI:58865614 SwissProt Q66HH1.1 344 RecName: Full=Beta-1,4-galactosyltransferase 4; Short=Beta-1,4-GalTase 4; Short=Beta4Gal-T4; Short=b4Gal-T4; AltName: Full=UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 4; AltName: Full=UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 4; Includes: RecName: Full=N-acetyllactosamine synthase; AltName: Full=Nal synthase; Includes: RecName: Full=Lactotriaosylceramide beta-1,4-galactosyltransferase; AltName: Full=Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase [Rattus norvegicus]

Related Sequences to LMP013237 proteins

Reference Database Accession Length Protein Name
GI:58865614 GenBank AAH81866.1 344 UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 4 [Rattus norvegicus]
GI:58865614 GenBank EDM11208.1 344 rCG52599, isoform CRA_a [Rattus norvegicus]
GI:58865614 GenBank EDM11209.1 344 rCG52599, isoform CRA_a [Rattus norvegicus]
GI:58865614 SwissProt Q66HH1.1 344 RecName: Full=Beta-1,4-galactosyltransferase 4; Short=Beta-1,4-GalTase 4; Short=Beta4Gal-T4; Short=b4Gal-T4; AltName: Full=UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 4; AltName: Full=UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 4; Includes: RecName: Full=N-acetyllactosamine synthase; AltName: Full=Nal synthase; Includes: RecName: Full=Lactotriaosylceramide beta-1,4-galactosyltransferase; AltName: Full=Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase [Rattus norvegicus]