Gene/Proteome Database (LMPD)
LMPD ID
LMP013238
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 6
Gene Symbol
Synonyms
Siat10;
Alternate Names
type 2 lactosamine alpha-2,3-sialyltransferase; ST3GalVI; ST3Gal VI; sialyltransferase 10 (alpha-2,3-sialyltransferase VI); CMP-NeuAc:beta-galactoside alpha-2,3-sialyltransferase VI;
Chromosome
11
Map Location
11q12
Proteins
| type 2 lactosamine alpha-2,3-sialyltransferase | |
|---|---|
| Refseq ID | NP_997485 |
| Protein GI | 62461588 |
| UniProt ID | Q569D2 |
| mRNA ID | NM_207602 |
| Length | 331 |
| MKGYVVAIFLSSIFLYYVLYCILWGTNGYWFPNEEMKSKNNVKNCFKKPAFASLLRFPQFYPFLCKADFVKVAATYGTNNFLLPYGVKTFESYFRSALSKLQSCDLFGEFDTVPCKRCVVVGNGGVLKNKTLGAKIDSYDVIIRMNNGPVLGHEEEVGKRTTFRLFYPESVFSDPSHYDPNTTAVLVVFKPQDLRWLMEILIGKKINTDGFWKKPALKLIYKQYQIRILDPYIIREAAFQLLRFPRVFPKDQKPKHPTTGIIALTLAFHICSEVHLAGFKYNFYTPDSPLHYYGNATMSLMKKNAYHNLTAEQLFLKNLIKKKMVINLTQN | |
Gene Information
Entrez Gene ID
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 6
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0030173 | IEA:InterPro | C | integral component of Golgi membrane |
| GO:0052798 | IEA:Ensembl | F | beta-galactoside alpha-2,3-sialyltransferase activity |
| GO:0071354 | IEA:Ensembl | P | cellular response to interleukin-6 |
| GO:0006664 | IEA:Ensembl | P | glycolipid metabolic process |
| GO:0009311 | IEA:Ensembl | P | oligosaccharide metabolic process |
| GO:0006486 | IEA:InterPro | P | protein glycosylation |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00601 | Glycosphingolipid biosynthesis - lacto and neolacto series |
| rno00601 | Glycosphingolipid biosynthesis - lacto and neolacto series |
| rno01100 | Metabolic pathways |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5953739 | Asparagine N-linked glycosylation |
| 5953738 | Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein |
| 5953253 | Disease |
| 5953252 | Glycogen storage diseases |
| 5953861 | Glycosaminoglycan metabolism |
| 5954344 | Keratan sulfate biosynthesis |
| 5954345 | Keratan sulfate/keratin metabolism |
| 5953870 | MPS I - Hurler syndrome |
| 5953869 | MPS II - Hunter syndrome |
| 5953872 | MPS IIIA - Sanfilippo syndrome A |
| 5953864 | MPS IIIB - Sanfilippo syndrome B |
| 5953867 | MPS IIIC - Sanfilippo syndrome C |
| 5953871 | MPS IIID - Sanfilippo syndrome D |
| 5953866 | MPS IV - Morquio syndrome A |
| 5953873 | MPS IV - Morquio syndrome B |
| 5953862 | MPS IX - Natowicz syndrome |
| 5953865 | MPS VI - Maroteaux-Lamy syndrome |
| 5953868 | MPS VII - Sly syndrome |
| 5953250 | Metabolism |
| 5953249 | Metabolism of carbohydrates |
| 5953345 | Metabolism of proteins |
| 5953863 | Mucopolysaccharidoses |
| 5953251 | Myoclonic epilepsy of Lafora |
| 5953728 | Post-translational protein modification |
| 5954523 | Pre-NOTCH Expression and Processing |
| 5954524 | Pre-NOTCH Processing in Golgi |
| 5954270 | Sialic acid metabolism |
| 5953381 | Signal Transduction |
| 5953700 | Signaling by NOTCH |
| 5953737 | Synthesis of substrates in N-glycan biosythesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 6
Protein Entry
Q569D2_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP013238 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 62461588 | RefSeq | NP_997485 | 331 | type 2 lactosamine alpha-2,3-sialyltransferase |
Identical Sequences to LMP013238 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:62461588 | GenBank | AAH92560.1 | 331 | ST3 beta-galactoside alpha-2,3-sialyltransferase 6 [Rattus norvegicus] |
| GI:62461588 | GenBank | EDM11018.1 | 331 | ST3 beta-galactoside alpha-2,3-sialyltransferase 6 [Rattus norvegicus] |
| GI:62461588 | RefSeq | XP_006248271.1 | 331 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Rattus norvegicus] |
| GI:62461588 | RefSeq | XP_006248272.1 | 331 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Rattus norvegicus] |
Related Sequences to LMP013238 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:62461588 | GenBank | AAH92560.1 | 331 | ST3 beta-galactoside alpha-2,3-sialyltransferase 6 [Rattus norvegicus] |
| GI:62461588 | GenBank | EDM11018.1 | 331 | ST3 beta-galactoside alpha-2,3-sialyltransferase 6 [Rattus norvegicus] |
| GI:62461588 | RefSeq | XP_006248271.1 | 331 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Rattus norvegicus] |
| GI:62461588 | RefSeq | XP_006248272.1 | 331 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Rattus norvegicus] |