Gene/Proteome Database (LMPD)

LMPD ID
LMP013244
Gene ID
304429
Species
Rattus norvegicus (Rat)
Gene Name
phosphoserine phosphatase
Gene Symbol
Psph
Alternate Names
phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase;
Chromosome
12
Map Location
12q13
EC Number
3.1.3.3

Proteins

phosphoserine phosphatase
Refseq ID NP_001009679
Protein GI 57527332
UniProt ID Q5M819
mRNA ID NM_001009679
Length 225
MVSHSELRKLFCSADAVCFDVDSTVIREEGIDELAKFCGVEAAVSEMTRRAMGGALPFKDALTERLALIQPSRDQVQRLLAEHPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVAAKLNIPTTNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIGFLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE

Gene Information

Entrez Gene ID
304429
Gene Name
phosphoserine phosphatase
Gene Symbol
Psph
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IBA:RefGenome C cytoplasm
GO:0043005 IDA:RGD C neuron projection
GO:0005509 ISS:UniProtKB F calcium ion binding
GO:0000287 ISS:UniProtKB F magnesium ion binding
GO:0004647 ISS:UniProtKB F phosphoserine phosphatase activity
GO:0016311 IBA:RefGenome P dephosphorylation
GO:0006564 IBA:RefGenome P L-serine biosynthetic process
GO:0006563 ISS:UniProtKB P L-serine metabolic process
GO:0009612 IEP:RGD P response to mechanical stimulus
GO:0031667 IEP:RGD P response to nutrient levels
GO:0033574 IEP:RGD P response to testosterone

KEGG Pathway Links

KEGG Pathway ID Description
ko01230 Biosynthesis of amino acids
rno01230 Biosynthesis of amino acids
ko01200 Carbon metabolism
rno01200 Carbon metabolism
ko00260 Glycine, serine and threonine metabolism
rno00260 Glycine, serine and threonine metabolism
rno01100 Metabolic pathways
M00020 Serine biosynthesis, glycerate-3P => serine

REACTOME Pathway Links

REACTOME Pathway ID Description
5953271 Amino acid synthesis and interconversion (transamination)
5953250 Metabolism
5953272 Metabolism of amino acids and derivatives
5954402 Serine biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR023214 HAD-like domain
IPR006383 HAD-superfamily hydrolase, subfamily IB, PSPase-like
IPR023190 Phosphoserine phosphatase, domain 2
IPR004469 Phosphoserine phosphatase SerB

UniProt Annotations

Entry Information

Gene Name
phosphoserine phosphatase
Protein Entry
SERB_RAT
UniProt ID
Q5M819
Species
Rat

Comments

Comment Type Description
Catalytic Activity O-phospho-L(or D)-serine + H(2)O = L(or D)- serine + phosphate.
Cofactor Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence= ; Note=Binds 1 Mg(2+) ion per subunit. ;
Function Catalyzes the last step in the biosynthesis of serine from carbohydrates. The reaction mechanism proceeds via the formation of a phosphoryl-enzyme intermediates (By similarity)
Pathway Amino-acid biosynthesis; L-serine biosynthesis; L-serine from 3-phospho-D-glycerate: step 3/3.
Similarity Belongs to the SerB family
Subunit Homodimer

Identical and Related Proteins

Unique RefSeq proteins for LMP013244 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
57527332 RefSeq NP_001009679 225 phosphoserine phosphatase

Identical Sequences to LMP013244 proteins

Reference Database Accession Length Protein Name
GI:57527332 GenBank EDM13488.1 225 phosphoserine phosphatase, isoform CRA_a [Rattus norvegicus]
GI:57527332 GenBank EDM13489.1 225 phosphoserine phosphatase, isoform CRA_a [Rattus norvegicus]
GI:57527332 GenBank EDM13491.1 225 phosphoserine phosphatase, isoform CRA_a [Rattus norvegicus]
GI:57527332 SwissProt Q5M819.1 225 RecName: Full=Phosphoserine phosphatase; Short=PSP; Short=PSPase; AltName: Full=O-phosphoserine phosphohydrolase [Rattus norvegicus]

Related Sequences to LMP013244 proteins

Reference Database Accession Length Protein Name
GI:57527332 GenBank AAH88310.1 225 Phosphoserine phosphatase [Rattus norvegicus]
GI:57527332 GenBank EDM13488.1 225 phosphoserine phosphatase, isoform CRA_a [Rattus norvegicus]
GI:57527332 GenBank EDM13489.1 225 phosphoserine phosphatase, isoform CRA_a [Rattus norvegicus]
GI:57527332 SwissProt Q5M819.1 225 RecName: Full=Phosphoserine phosphatase; Short=PSP; Short=PSPase; AltName: Full=O-phosphoserine phosphohydrolase [Rattus norvegicus]