Gene/Proteome Database (LMPD)
LMPD ID
LMP013264
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2
Gene Symbol
Synonyms
B3gnt1;
Alternate Names
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 1;
Chromosome
14
Map Location
14q22
Proteins
| UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2 | |
|---|---|
| Refseq ID | NP_001100710 |
| Protein GI | 157822021 |
| UniProt ID | D3ZEF9 |
| mRNA ID | NM_001107240 |
| Length | 397 |
| MSVGRRRVRLLGILMTANVFIYLIVEVSKSSSQDKNGKGGVIIPKEKFWKLSSLPRAYWNREQEKLNRWYNPILNRVANQTGDLFTSPNTSHLNYCEPDSTVMTAVTDFNNLPDRFKDFLLYLRCRNYSLLIDQPKKCAKKPFLLLAIKSLIPHFARRQAIRESWGRETNVGNQTVVRVFLLGKTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDAEFVFKGDDDVFVNTHHILNYLNSLSKSKAKDLFIGDVIHNAGPHRDKKLKYYIPEVFYTGVYPPYAGGGGFLYSGPLALRLYNVTDRVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKKNICSYIDLMLVHSRKPQEMIDIWSQLQSPNLKC | |
Gene Information
Entrez Gene ID
Gene Name
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0008378 | IEA:InterPro | F | galactosyltransferase activity |
| GO:0007411 | IEA:Ensembl | P | axon guidance |
| GO:0006486 | IEA:Ensembl | P | protein glycosylation |
| GO:0007608 | IEA:Ensembl | P | sensory perception of smell |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00533 | Glycosaminoglycan biosynthesis - keratan sulfate |
| rno00533 | Glycosaminoglycan biosynthesis - keratan sulfate |
| ko00601 | Glycosphingolipid biosynthesis - lacto and neolacto series |
| rno00601 | Glycosphingolipid biosynthesis - lacto and neolacto series |
| rno01100 | Metabolic pathways |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5953253 | Disease |
| 5953252 | Glycogen storage diseases |
| 5953861 | Glycosaminoglycan metabolism |
| 5954344 | Keratan sulfate biosynthesis |
| 5954345 | Keratan sulfate/keratin metabolism |
| 5953870 | MPS I - Hurler syndrome |
| 5953869 | MPS II - Hunter syndrome |
| 5953872 | MPS IIIA - Sanfilippo syndrome A |
| 5953864 | MPS IIIB - Sanfilippo syndrome B |
| 5953867 | MPS IIIC - Sanfilippo syndrome C |
| 5953871 | MPS IIID - Sanfilippo syndrome D |
| 5953866 | MPS IV - Morquio syndrome A |
| 5953873 | MPS IV - Morquio syndrome B |
| 5953862 | MPS IX - Natowicz syndrome |
| 5953865 | MPS VI - Maroteaux-Lamy syndrome |
| 5953868 | MPS VII - Sly syndrome |
| 5953250 | Metabolism |
| 5953249 | Metabolism of carbohydrates |
| 5953345 | Metabolism of proteins |
| 5953863 | Mucopolysaccharidoses |
| 5953251 | Myoclonic epilepsy of Lafora |
| 5954369 | O-linked glycosylation |
| 5954368 | O-linked glycosylation of mucins |
| 5953728 | Post-translational protein modification |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002659 | Glycosyl transferase, family 31 |
UniProt Annotations
Entry Information
Gene Name
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2
Protein Entry
D3ZEF9_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP013264 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 157822021 | RefSeq | NP_001100710 | 397 | UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2 |
Identical Sequences to LMP013264 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157822021 | RefSeq | XP_006251616.1 | 397 | PREDICTED: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2 isoform X1 [Rattus norvegicus] |
| GI:157822021 | RefSeq | XP_006251617.1 | 397 | PREDICTED: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2 isoform X1 [Rattus norvegicus] |
| GI:157822021 | RefSeq | XP_006251618.1 | 397 | PREDICTED: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2 isoform X1 [Rattus norvegicus] |
| GI:157822021 | RefSeq | XP_008768649.1 | 397 | PREDICTED: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2 isoform X1 [Rattus norvegicus] |
Related Sequences to LMP013264 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157822021 | GenBank | EDL97972.1 | 397 | UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 1 (predicted), isoform CRA_a [Rattus norvegicus] |
| GI:157822021 | RefSeq | XP_006251617.1 | 397 | PREDICTED: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2 isoform X1 [Rattus norvegicus] |
| GI:157822021 | RefSeq | XP_006251618.1 | 397 | PREDICTED: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2 isoform X1 [Rattus norvegicus] |
| GI:157822021 | RefSeq | XP_008768649.1 | 397 | PREDICTED: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2 isoform X1 [Rattus norvegicus] |