Gene/Proteome Database (LMPD)
Proteins
angiogenin precursor | |
---|---|
Refseq ID | NP_001006993 |
Protein GI | 55742836 |
UniProt ID | Q5WRG2 |
mRNA ID | NM_001006992 |
Length | 145 |
MEMSLRPLLSVFVLGLVSTPSTLAQDDPRYTKFLTQHYDAKPKGRDARYCESMMRRRGLTSPCKEVNTFIHGNKGSIKAICGANGSPYGENLRISQSPFQITTCKHTGGSPRPPCRYRASAGFRHVVIACENGLPVHFDESFISL | |
sig_peptide: 1..24 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2562 peptide sequence: MEMSLRPLLSVFVLGLVSTPSTLA |
Gene Information
Entrez Gene ID
Gene Name
angiogenin, ribonuclease, RNase A family, 5
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0032311 | ISS:UniProtKB | C | angiogenin-PRI complex |
GO:0005605 | ISS:UniProtKB | C | basal lamina |
GO:0005615 | ISS:UniProtKB | C | extracellular space |
GO:0005730 | IDA:UniProtKB | C | nucleolus |
GO:0005634 | ISS:UniProtKB | C | nucleus |
GO:0003779 | ISS:UniProtKB | F | actin binding |
GO:0005507 | ISS:UniProtKB | F | copper ion binding |
GO:0004519 | IEA:UniProtKB-KW | F | endonuclease activity |
GO:0008201 | ISS:UniProtKB | F | heparin binding |
GO:0003676 | IEA:InterPro | F | nucleic acid binding |
GO:0005102 | ISS:UniProtKB | F | receptor binding |
GO:0004540 | ISS:UniProtKB | F | ribonuclease activity |
GO:0090501 | ISS:GOC | P | RNA phosphodiester bond hydrolysis |
GO:0030041 | ISS:UniProtKB | P | actin filament polymerization |
GO:0032431 | ISS:UniProtKB | P | activation of phospholipase A2 activity |
GO:0007202 | IDA:UniProtKB | P | activation of phospholipase C activity |
GO:0001525 | ISS:UniProtKB | P | angiogenesis |
GO:0006651 | ISS:UniProtKB | P | diacylglycerol biosynthetic process |
GO:0001889 | IEP:RGD | P | liver development |
GO:0048662 | ISS:UniProtKB | P | negative regulation of smooth muscle cell proliferation |
GO:0001938 | ISS:UniProtKB | P | positive regulation of endothelial cell proliferation |
GO:0050714 | ISS:UniProtKB | P | positive regulation of protein secretion |
GO:0009303 | ISS:UniProtKB | P | rRNA transcription |
GO:0001666 | ISS:UniProtKB | P | response to hypoxia |
Domain Information
UniProt Annotations
Entry Information
Gene Name
angiogenin, ribonuclease, RNase A family, 5
Protein Entry
Q5WRG2_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP013269 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
55742836 | RefSeq | NP_001006993 | 145 | angiogenin precursor |
Identical Sequences to LMP013269 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:55742836 | GenBank | AAR28758.1 | 145 | angiogenin precursor [Rattus norvegicus] |
Related Sequences to LMP013269 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:55742836 | GenBank | AAR28758.1 | 145 | angiogenin precursor [Rattus norvegicus] |
GI:55742836 | GenBank | AAV87193.1 | 145 | angiogenin ribonuclease 1 [Rattus norvegicus] |
GI:55742836 | GenBank | EDL88436.1 | 145 | ribonuclease, RNase A family 4, isoform CRA_a [Rattus norvegicus] |
GI:55742836 | tpe | CDG32031.1 | 145 | TPA: ribonuclease A a1 [Rattus norvegicus] |