Gene/Proteome Database (LMPD)
LMPD ID
LMP013271
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
mediator complex subunit 4
Gene Symbol
Synonyms
Vdrip;
Alternate Names
mediator of RNA polymerase II transcription subunit 4; vitamin D receptor interacting protein; mediator of RNA polymerase II transcription, subunit 4 homolog;
Chromosome
15
Map Location
15p11
Proteins
| mediator of RNA polymerase II transcription subunit 4 | |
|---|---|
| Refseq ID | NP_001019427 |
| Protein GI | 66730397 |
| UniProt ID | Q561Q8 |
| mRNA ID | NM_001024256 |
| Length | 270 |
| MAASSSGEKEKERMGGVSGMTGLGSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQLEEENQVLELLIHRDGDFQELMKLALNQGKVHHEMQALEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTSGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSVNMLPPNHSTDFLLEPPGHNKENEDDVEVMSTDSSSSSSDSD | |
Gene Information
Entrez Gene ID
Gene Name
mediator complex subunit 4
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016592 | IEA:Ensembl | C | mediator complex |
| GO:0001104 | IEA:Ensembl | F | RNA polymerase II transcription cofactor activity |
| GO:0004872 | IEA:Ensembl | F | receptor activity |
| GO:0030521 | IEA:Ensembl | P | androgen receptor signaling pathway |
| GO:0045893 | IEA:Ensembl | P | positive regulation of transcription, DNA-templated |
| GO:0006367 | IEA:Ensembl | P | transcription initiation from RNA polymerase II promoter |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| rno04919 | Thyroid hormone signaling pathway |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5953533 | Developmental Biology |
| 5953288 | Fatty acid, triacylglycerol, and ketone body metabolism |
| 5953330 | Gene Expression |
| 5953833 | Generic Transcription Pathway |
| 5953250 | Metabolism |
| 5953289 | Metabolism of lipids and lipoproteins |
| 5954333 | PPARA activates gene expression |
| 5954222 | Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha) |
| 5954166 | Transcriptional regulation of white adipocyte differentiation |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR019258 | Mediator complex, subunit Med4 |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity) |
| Similarity | Belongs to the Mediator complex subunit 4 family |
| Subcellular Location | Nucleus . |
| Subunit | Component of the Mediator complex, which is composed of MED1, MED4, MED6, MED7, MED8, MED9, MED10, MED11, MED12, MED13, MED13L, MED14, MED15, MED16, MED17, MED18, MED19, MED20, MED21, MED22, MED23, MED24, MED25, MED26, MED27, MED29, MED30, MED31, CCNC, CDK8 and CDC2L6/CDK11. The MED12, MED13, CCNC and CDK8 subunits form a distinct module termed the CDK8 module. Mediator containing the CDK8 module is less active than Mediator lacking this module in supporting transcriptional activation. Individual preparations of the Mediator complex lacking one or more distinct subunits have been variously termed ARC, CRSP, DRIP, PC2, SMCC and TRAP (By similarity) |
Identical and Related Proteins
Unique RefSeq proteins for LMP013271 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 66730397 | RefSeq | NP_001019427 | 270 | mediator of RNA polymerase II transcription subunit 4 |
Identical Sequences to LMP013271 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:66730397 | GenBank | AAH93402.1 | 270 | Mediator complex subunit 4 [Rattus norvegicus] |
| GI:66730397 | SwissProt | Q561Q8.1 | 270 | RecName: Full=Mediator of RNA polymerase II transcription subunit 4; AltName: Full=Mediator complex subunit 4 [Rattus norvegicus] |
Related Sequences to LMP013271 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:66730397 | DBBJ | BAB27118.1 | 270 | unnamed protein product [Mus musculus] |
| GI:66730397 | GenBank | AAH93402.1 | 270 | Mediator complex subunit 4 [Rattus norvegicus] |
| GI:66730397 | GenBank | EDM02270.1 | 279 | mediator of RNA polymerase II transcription, subunit 4 homolog (yeast) [Rattus norvegicus] |
| GI:66730397 | SwissProt | Q561Q8.1 | 270 | RecName: Full=Mediator of RNA polymerase II transcription subunit 4; AltName: Full=Mediator complex subunit 4 [Rattus norvegicus] |