Gene/Proteome Database (LMPD)

LMPD ID
LMP013273
Gene ID
306262
Species
Rattus norvegicus (Rat)
Gene Name
biotinidase
Gene Symbol
Btd
Alternate Names
biotinidase; biotinase; btd {ECO:0000312|EMBL:AAH90017.1};
Chromosome
16
Map Location
16p16
EC Number
3.5.1.12

Proteins

biotinidase precursor
Refseq ID NP_001012047
Protein GI 58865670
UniProt ID Q5FVF9
mRNA ID NM_001012047
Length 521
MSGARTAHALVFLLGCSALALGVCSASLEHGEAEYYVAAVYEHRSVLSPNPLELSSRQQALELMKQNLDVYEQQVMAAAQKGAHIIVFPEDGIHGFNFTRTSIYPFLDLMPSPRLVSWNPCLEPFRFNDTEVLQRLSCMAIKGKMFLVANLGTKQPCLGSDPGCPQDGRYQFNTNVAFSDNGTLVGRYRKHNLYFEEAFDSPADVDLTTFDTPFAGKFGMFTCFDILFFDPAVRLLRDFEVKHIAYPTAWMNQLPLLAAIEIQKAFATAFGVTVLAANIHHPTLGMTGSGIHTPLKSFWYHNMDDPEGHLIIARVATNPQGLVGTENTTSEMDPSHRKFLKVLSGDPYCEKDAQEVRCDEAAKWNLNAPPTFHSEMMYDNFTLVPVWGKEGHLQVCSNSLCCHLLFERPALSKELYALGVFDGLHTVHGTYYVQACALVKCGGAGFETCGQEISEAEGLFDFHLWGNFSTLYVFPLFLTSGMTLDTPDQLGWESDHYFLRKRGLSSGLVTAALYGRLYERN
sig_peptide: 1..22 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2160 peptide sequence: MSGARTAHALVFLLGCSALALG

Gene Information

Entrez Gene ID
306262
Gene Name
biotinidase
Gene Symbol
Btd
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0045177 IEA:Ensembl C apical part of cell
GO:0005615 IEA:Ensembl C extracellular space
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0005730 IEA:Ensembl C nucleolus
GO:0043204 IEA:Ensembl C perikaryon
GO:0047708 IEA:UniProtKB-EC F biotinidase activity
GO:0006768 IEA:Ensembl P biotin metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00780 Biotin metabolism
rno00780 Biotin metabolism
rno01100 Metabolic pathways
ko04977 Vitamin digestion and absorption
rno04977 Vitamin digestion and absorption

REACTOME Pathway Links

REACTOME Pathway ID Description
5954011 Biotin transport and metabolism
5953298 Defective AMN causes hereditary megaloblastic anemia 1
5953308 Defective BTD causes biotidinase deficiency
5953307 Defective CD320 causes methylmalonic aciduria
5953299 Defective CUBN causes hereditary megaloblastic anemia 1
5953296 Defective GIF causes intrinsic factor deficiency
5953310 Defective HLCS causes multiple carboxylase deficiency
5953297 Defective LMBRD1 causes methylmalonic aciduria and homocystinuria type cblF
5953305 Defective MMAA causes methylmalonic aciduria type cblA
5953302 Defective MMAB causes methylmalonic aciduria type cblB
5953304 Defective MMACHC causes methylmalonic aciduria and homocystinuria type cblC
5953303 Defective MMADHC causes methylmalonic aciduria and homocystinuria type cblD
5953301 Defective MTR causes methylmalonic aciduria and homocystinuria type cblG
5953300 Defective MTRR causes methylmalonic aciduria and homocystinuria type cblE
5953306 Defective MUT causes methylmalonic aciduria mut type
5953293 Defective TCN2 causes hereditary megaloblastic anemia
5953309 Defects in biotin (Btn) metabolism
5953294 Defects in cobalamin (B12) metabolism
5953295 Defects in vitamin and cofactor metabolism
5953253 Disease
5953250 Metabolism
5953292 Metabolism of vitamins and cofactors
5953291 Metabolism of water-soluble vitamins and cofactors

Domain Information

InterPro Annotations

Accession Description
IPR012101 Biotinidase, eukaryotic
IPR003010 Carbon-nitrogen hydrolase

UniProt Annotations

Entry Information

Gene Name
biotinidase
Protein Entry
BTD_RAT
UniProt ID
Q5FVF9
Species
Rat

Comments

Comment Type Description
Catalytic Activity Biotin amide + H(2)O = biotin + NH(3)
Function Catalytic release of biotin from biocytin, the product of biotin-dependent carboxylases degradation
Similarity Belongs to the carbon-nitrogen hydrolase superfamily. BTD/VNN family
Similarity Contains 1 CN hydrolase domain. {ECO:0000255|PROSITE- ProRule:PRU00054}.
Subcellular Location Secreted, extracellular space .

Identical and Related Proteins

Unique RefSeq proteins for LMP013273 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
58865670 RefSeq NP_001012047 521 biotinidase precursor

Identical Sequences to LMP013273 proteins

Reference Database Accession Length Protein Name
GI:58865670 RefSeq XP_006252679.1 521 PREDICTED: biotinidase isoform X1 [Rattus norvegicus]
GI:58865670 RefSeq XP_006252680.1 521 PREDICTED: biotinidase isoform X1 [Rattus norvegicus]
GI:58865670 RefSeq XP_006252684.1 521 PREDICTED: biotinidase isoform X1 [Rattus norvegicus]
GI:58865670 RefSeq XP_008769221.1 521 PREDICTED: biotinidase isoform X1 [Rattus norvegicus]

Related Sequences to LMP013273 proteins

Reference Database Accession Length Protein Name
GI:58865670 RefSeq XP_006252674.1 521 PREDICTED: biotinidase isoform X1 [Rattus norvegicus]
GI:58865670 RefSeq XP_006252676.1 521 PREDICTED: biotinidase isoform X1 [Rattus norvegicus]
GI:58865670 RefSeq XP_006252677.1 521 PREDICTED: biotinidase isoform X1 [Rattus norvegicus]
GI:58865670 RefSeq XP_006252678.1 521 PREDICTED: biotinidase isoform X1 [Rattus norvegicus]