Gene/Proteome Database (LMPD)
Proteins
| fatty acid 2-hydroxylase | |
|---|---|
| Refseq ID | NP_001129055 |
| Protein GI | 207446698 |
| UniProt ID | Q2LAM0 |
| mRNA ID | NM_001135583 |
| Length | 372 |
| MAPAPPPAASFTSAEVQRRLAAGACWVRRGASLYDLTGFVRHHPGGEQLLLARAGQDISADLDGPPHKHSDNARRWLEQYYVGELRADPQDPTENGAGAPAETQKTDAAIEPQFKVVDWDKDLVDWQKPLLWQVGHLGEKYDEWVHQPVARPIRLFHSDLIEAFSKTVWYSVPIIWVPLVLYLSWSYYRTLTQDNIRLFASFTRDYSLVVPESVFIGLFVLGMLIWTLVEYLIHRFLFHMKPPSNSHYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASVVVAFFYVFLRLILPEAVAGILFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYNMKAHHVKHHFEYQKSGFGISTKLWDYFFHTLIPEEADPKMQ | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0080132 | IEA:Ensembl | F | fatty acid alpha-hydroxylase activity |
| GO:0020037 | IEA:InterPro | F | heme binding |
| GO:0005506 | IEA:InterPro | F | iron ion binding |
| GO:0032286 | IEA:Ensembl | P | central nervous system myelin maintenance |
| GO:0006633 | IEA:UniProtKB-KW | P | fatty acid biosynthetic process |
| GO:0030258 | IEA:Ensembl | P | lipid modification |
| GO:0032287 | IEA:Ensembl | P | peripheral nervous system myelin maintenance |
| GO:0042127 | IEA:Ensembl | P | regulation of cell proliferation |
| GO:0042634 | IEA:Ensembl | P | regulation of hair cycle |
| GO:0001949 | IEA:Ensembl | P | sebaceous gland cell differentiation |
| GO:0006665 | IEA:InterPro | P | sphingolipid metabolic process |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence= ; |
| Developmental Stage | Detected at low levels in sciatic nerve from newborns. Levels increase strongly during the first 3 weeks, and decrease thereafter to reach a low, constitutive level in 4 week olds. Expressed at a low, constitutive level in adults |
| Domain | The histidine box domains may contain the active site and/or be involved in metal ion binding. |
| Function | Required for alpha-hydroxylation of free fatty acids and the formation of alpha-hydroxylated sphingolipids |
| Induction | Up-regulated in sciatic nerve during myelination. Up- regulated in differentiating cultured Schwann cells |
| Similarity | Belongs to the sterol desaturase family. SCS7 subfamily |
| Similarity | Contains 1 cytochrome b5 heme-binding domain |
| Subcellular Location | Endoplasmic reticulum membrane; Multi-pass membrane protein. Microsome membrane ; Multi-pass membrane protein . |
| Tissue Specificity | Detected in oligodendrocytes (at protein level). Detected in sciatic nerve. {ECO:0000269|PubMed:16998236, ECO:0000269|PubMed:17901466}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP013292 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 207446698 | RefSeq | NP_001129055 | 372 | fatty acid 2-hydroxylase |
Identical Sequences to LMP013292 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:207446698 | SwissProt | Q2LAM0.2 | 372 | RecName: Full=Fatty acid 2-hydroxylase; AltName: Full=Fatty acid alpha-hydroxylase [Rattus norvegicus] |
Related Sequences to LMP013292 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:207446698 | GenBank | EDL11497.1 | 372 | fatty acid 2-hydroxylase, isoform CRA_a [Mus musculus] |
| GI:207446698 | RefSeq | NP_835187.2 | 372 | fatty acid 2-hydroxylase [Mus musculus] |
| GI:207446698 | SwissProt | Q5MPP0.1 | 372 | RecName: Full=Fatty acid 2-hydroxylase; AltName: Full=Fatty acid alpha-hydroxylase [Mus musculus] |
| GI:207446698 | SwissProt | Q2LAM0.2 | 372 | RecName: Full=Fatty acid 2-hydroxylase; AltName: Full=Fatty acid alpha-hydroxylase [Rattus norvegicus] |