LIPID MAPS

LMPD ID

LMP013302

Gene ID

Species

Rattus norvegicus (Rat)

Gene Name

mesoderm development candidate 2

Gene Symbol

Alternate Names

LDLR chaperone MESD; mesoderm development protein; mesoderm development candiate 2;

Chromosome

1

Map Location

1q31

LDLR chaperone MESD precursor
Refseq ID	NP_001008346
Protein GI	56605768
UniProt ID	Q5U2R7
mRNA ID	NM_001008345
Length	224
MAASSWLRAVLLFLCASDLLLLSPPEAYATDTPGEAITPPRKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPIDFSKLDPGKPESILKMTKKGKTLMMFVTISGNPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVNQDRCAEVTLEGQMYPGKGGGSKEKNKTKPEKGKKKEGDPKPRASKEDNRAGSRREDL
sig_peptide: 1..29 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 3123 peptide sequence: MAASSWLRAVLLFLCASDLLLLSPPEAYA mat_peptide: 30..224 product: LDLR chaperone MESD experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q5U2R7.1) calculated_mol_wt: 22111 peptide sequence: TDTPGEAITPPRKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPIDFSKLDPGKPESILKMTKKGKTLMMFVTISGNPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVNQDRCAEVTLEGQMYPGKGGGSKEKNKTKPEKGKKKEGDPKPRASKEDNRAGSRREDL

Entrez Gene ID

Gene Name

mesoderm development candidate 2

Gene Symbol

Species

Rattus norvegicus

GO ID	Source	Type	Description
GO:0005783	IEA:UniProtKB-KW	C	endoplasmic reticulum
GO:0005886	IEA:Ensembl	C	plasma membrane
GO:0016055	IEA:UniProtKB-KW	P	Wnt signaling pathway
GO:0006457	ISS:UniProtKB	P	protein folding
GO:0034394	IEA:Ensembl	P	protein localization to cell surface

Accession	Description
IPR019330	Mesoderm development candidate 2

Gene Name

mesoderm development candidate 2

Protein Entry

MESD_RAT

UniProt ID

Species

Rat

Comment Type	Description
Domain	The chaperone domain provides a folding template for proper folding of the beta-propeller (BP) domains of LRP5/6
Domain	The escort domain ensures LRP5/6 safe-trafficking from the ER to the Golgi by preventing premature ligand-binding
Function	Chaperone specifically assisting the folding of beta- propeller/EGF modules within the family of low-density lipoprotein receptors (LDLRs). Acts as a modulator of the Wnt pathway through chaperoning the coreceptors of the canonical Wnt pathway, LRP5 and LRP6, to the plasma membrane. Essential for specification of embryonic polarity and mesoderm induction (By similarity)
Similarity	Belongs to the MESD family
Subcellular Location	Endoplasmic reticulum .
Subunit	Monomer (By similarity). Interacts with LRP5; the interaction prevents LRP5 from forming aggregates and chaperones LRP6 to the plasma membrane. Interacts with LRP6; the interaction prevents LRP6 from forming aggregates and chaperones LRP6 to the plasma membrane (By similarity)

Protein GI	Database	Accession	Length	Protein Name
56605768	RefSeq	NP_001008346	224	LDLR chaperone MESD precursor

Reference	Database	Accession	Length	Protein Name
GI:56605768	GenBank	EDM08759.1	224	mesoderm development candiate 2, isoform CRA_b [Rattus norvegicus]
GI:56605768	GenBank	EDM08760.1	224	mesoderm development candiate 2, isoform CRA_b [Rattus norvegicus]
GI:56605768	GenBank	AFN91460.1	224	Sequence 37 from patent US 8198236
GI:56605768	SwissProt	Q5U2R7.1	224	RecName: Full=LDLR chaperone MESD; AltName: Full=Mesoderm development candidate 2; AltName: Full=Mesoderm development protein; Flags: Precursor [Rattus norvegicus]

Reference	Database	Accession	Length	Protein Name
GI:56605768	GenBank	AAH85892.1	224	Mesoderm development candidate 2 [Rattus norvegicus]
GI:56605768	GenBank	EDM08759.1	224	mesoderm development candiate 2, isoform CRA_b [Rattus norvegicus]
GI:56605768	GenBank	EDM08760.1	224	mesoderm development candiate 2, isoform CRA_b [Rattus norvegicus]
GI:56605768	SwissProt	Q5U2R7.1	224	RecName: Full=LDLR chaperone MESD; AltName: Full=Mesoderm development candidate 2; AltName: Full=Mesoderm development protein; Flags: Precursor [Rattus norvegicus]