Gene/Proteome Database (LMPD)

LMPD ID
LMP013304
Gene ID
309004
Species
Rattus norvegicus (Rat)
Gene Name
vitamin K epoxide reductase complex, subunit 1
Gene Symbol
Vkorc1
Alternate Names
vitamin K epoxide reductase complex subunit 1; Warfarin resistance; phylloquinone epoxide reductase; vitamin K1 2,3-epoxide reductase subunit 1; vitamin K1 epoxide reductase (warfarin-sensitive);
Chromosome
1
Map Location
1q36
EC Number
1.1.4.1
Summary
Vitamin K is essential for blood clotting but must be enzymatically activated. This enzymatically activated form of vitamin K is a reduced form required for the carboxylation of glutamic acid residues in some blood-clotting proteins. The product of this gene encodes the enzyme that is responsible for reducing vitamin K 2,3-epoxide to the enzymatically activated form. Fatal bleeding can be caused by vitamin K deficiency and by the vitamin K antagonist warfarin, and it is the product of this gene that is sensitive to warfarin. In humans, mutations in this gene can be associated with deficiencies in vitamin-K-dependent clotting factors and, in humans and rats, with warfarin resistance. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for Vkorc1

Proteins

vitamin K epoxide reductase complex subunit 1 precursor
Refseq ID NP_976080
Protein GI 42627871
UniProt ID Q6TEK4
mRNA ID NM_203335
Length 161
MGTTWRSPGRLRLALCLAGLALSLYALHVKAARARNEDYRALCDVGTAISCSRVFSSRWGRGFGLVEHVLGADSILNQSNSIFGCMFYTIQLLLGCLRGRWASILLILSSLVSVAGSLYLAWILFFVLYDFCIVCITTYAINAGLMLLSFQKVPEHKVKKP
sig_peptide: 1..31 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 3340 peptide sequence: MGTTWRSPGRLRLALCLAGLALSLYALHVKA

Gene Information

Entrez Gene ID
309004
Gene Name
vitamin K epoxide reductase complex, subunit 1
Gene Symbol
Vkorc1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0043231 IDA:RGD C intracellular membrane-bounded organelle
GO:0048038 IEA:UniProtKB-KW F quinone binding
GO:0047058 IDA:RGD F vitamin-K-epoxide reductase (warfarin-insensitive) activity
GO:0047057 IEA:UniProtKB-EC F vitamin-K-epoxide reductase (warfarin-sensitive) activity
GO:0007596 ISS:UniProtKB P blood coagulation
GO:0060348 ISS:UniProtKB P bone development
GO:0017187 ISS:UniProtKB P peptidyl-glutamic acid carboxylation
GO:0030193 IMP:RGD P regulation of blood coagulation
GO:0046677 IDA:RGD P response to antibiotic
GO:0014070 IDA:RGD P response to organic cyclic compound
GO:0010243 IDA:RGD P response to organonitrogen compound
GO:0042373 ISS:UniProtKB P vitamin K metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00130 Ubiquinone and other terpenoid-quinone biosynthesis
rno00130 Ubiquinone and other terpenoid-quinone biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5953726 Gamma-carboxylation, transport, and amino-terminal cleavage of proteins
5953345 Metabolism of proteins
5953727 PTM: gamma carboxylation, hypusine formation and arylsulfatase activation
5953728 Post-translational protein modification

Domain Information

InterPro Annotations

Accession Description
IPR012932 Vitamin K epoxide reductase

UniProt Annotations

Entry Information

Gene Name
vitamin K epoxide reductase complex, subunit 1
Protein Entry
VKOR1_RAT
UniProt ID
Q6TEK4
Species
Rat

Comments

Comment Type Description
Catalytic Activity 2-methyl-3-phytyl-1,4-naphthoquinone + oxidized dithiothreitol = 2,3-epoxy-2,3-dihydro-2-methyl-3-phytyl- 1,4-naphthoquinone + 1,4-dithiothreitol. {ECO:0000269|PubMed:15640149, ECO:0000269|PubMed:23772386, ECO:0000269|PubMed:23928358}.
Domain The number of transmembrane domains and the membrane topology are controversial; supporting evidence is available both for models with three transmembrane domains and four transmembrane domains
Enzyme Regulation Inhibited by warfarin (coumadin). {ECO:0000269|PubMed:15879509, ECO:0000269|PubMed:23772386, ECO:0000269|PubMed:23928358}.
Function Involved in vitamin K metabolism. Catalytic subunit of the vitamin K epoxide reductase (VKOR) complex which reduces inactive vitamin K 2,3-epoxide to active vitamin K. Vitamin K is required for the gamma-carboxylation of various proteins, including clotting factors, and is required for normal blood coagulation, but also for normal bone development. {ECO:0000269|PubMed:15640149, ECO:0000269|PubMed:15879509, ECO:0000269|PubMed:23772386, ECO:0000269|PubMed:23928358}.
Miscellaneous The location of two cysteine active-site residues within a proposed transmembrane is consistent both with the known hydrophobic environment of the thiol redox site of the enzyme and with the lipophilicity of vitamin K and warfarin (coumadin).
Similarity Belongs to the VKOR family
Subcellular Location Endoplasmic reticulum membrane ; Multi- pass membrane protein {ECO:0000269|PubMed:23772386, ECO:0000269|PubMed:23928358}.
Tissue Specificity Highly expressed in liver. Detected at lower levels in lung, kidney and testis

Identical and Related Proteins

Unique RefSeq proteins for LMP013304 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
42627871 RefSeq NP_976080 161 vitamin K epoxide reductase complex subunit 1 precursor

Identical Sequences to LMP013304 proteins

Reference Database Accession Length Protein Name
GI:42627871 GenBank EDM17218.1 161 vitamin K epoxide reductase complex, subunit 1, isoform CRA_a [Rattus norvegicus]
GI:42627871 GenBank AAI66413.1 161 Vitamin K epoxide reductase complex, subunit 1 [Rattus norvegicus]
GI:42627871 GenBank AEF74456.1 161 Sequence 12 from patent US 7939250
GI:42627871 SwissProt Q6TEK4.1 161 RecName: Full=Vitamin K epoxide reductase complex subunit 1; AltName: Full=Vitamin K1 2,3-epoxide reductase subunit 1 [Rattus norvegicus]

Related Sequences to LMP013304 proteins

Reference Database Accession Length Protein Name
GI:42627871 GenBank AAR82917.1 161 vitamin K epoxide reductase complex subunit 1 [Rattus norvegicus]
GI:42627871 GenBank AAI66413.1 161 Vitamin K epoxide reductase complex, subunit 1 [Rattus norvegicus]
GI:42627871 GenBank AEF74456.1 161 Sequence 12 from patent US 7939250
GI:42627871 SwissProt Q6TEK4.1 161 RecName: Full=Vitamin K epoxide reductase complex subunit 1; AltName: Full=Vitamin K1 2,3-epoxide reductase subunit 1 [Rattus norvegicus]