Gene/Proteome Database (LMPD)

LMPD ID
LMP013315
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
ELOVL fatty acid elongase 3
Gene Symbol
Alternate Names
elongation of very long chain fatty acids protein 3; elongation of very long chain fatty acids-like 3; elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3;
Chromosome
1
Map Location
1q54
EC Number
2.3.1.199

Proteins

elongation of very long chain fatty acids protein 3
Refseq ID NP_001101072
Protein GI 157821353
UniProt ID D3ZPX9
mRNA ID NM_001107602
Length 271
MDTSMNFSRGLKTELIQPYDFEMSQDLRPFLEEYWVSSFFIVLVYLLLIIFGQNYMKTRKGFSLQRPLILWSFCLAIFSILGTLRMWKFMGTVLFTMGLKQTVCFTDYTNDAIVKFWSWVFLLSKVVELGDTAFIILRKRPLIFVHWYHHSTVLLFTSFGYKNKVPSGGWFMTMNLGVHSVMYTYYTMKAAKVKHPNILPMVITSLQILQMVLGTIFGILNYIWRQERGCYTTSEHFFWSFVLYGTYFILFAQFFHRAYLRPKRKAESKSQ

Gene Information

Entrez Gene ID
Gene Name
ELOVL fatty acid elongase 3
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:Ensembl C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016740 IEA:UniProtKB-KW F transferase activity
GO:0034625 IEA:Ensembl P fatty acid elongation, monounsaturated fatty acid
GO:0034626 IEA:Ensembl P fatty acid elongation, polyunsaturated fatty acid
GO:0019367 IEA:Ensembl P fatty acid elongation, saturated fatty acid
GO:0042761 IEA:Ensembl P very long-chain fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
M00415 Fatty acid biosynthesis, elongation, endoplasmic reticulum
ko00062 Fatty acid elongation
rno00062 Fatty acid elongation

REACTOME Pathway Links

REACTOME Pathway ID Description
5954223 Circadian Clock
5953463 Fatty Acyl-CoA Biosynthesis
5953288 Fatty acid, triacylglycerol, and ketone body metabolism
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5954224 REV-ERBA represses gene expression
5953471 Synthesis of very long-chain fatty acyl-CoAs
5953464 Triglyceride Biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR002076 ELO family

UniProt Annotations

Entry Information

Gene Name
ELOVL fatty acid elongase 3
Protein Entry
D3ZPX9_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2)
Similarity Belongs to the ELO family

Identical and Related Proteins

Unique RefSeq proteins for LMP013315 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
157821353 RefSeq NP_001101072 271 elongation of very long chain fatty acids protein 3

Identical Sequences to LMP013315 proteins

Reference Database Accession Length Protein Name
GI:157821353 GenBank EDL94335.1 271 elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3 (predicted) [Rattus norvegicus]

Related Sequences to LMP013315 proteins

Reference Database Accession Length Protein Name
GI:157821353 GenBank ABH98606.1 271 Sequence 50 from patent US 7070970
GI:157821353 GenBank EDL94335.1 271 elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3 (predicted) [Rattus norvegicus]
GI:157821353 GenBank AEJ72113.1 271 Sequence 53 from patent US 7968692
GI:157821353 RefSeq NP_031729.1 271 elongation of very long chain fatty acids protein 3 [Mus musculus]