Gene/Proteome Database (LMPD)

LMPD ID
LMP013357
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
ALG2, alpha-1,3/1,6-mannosyltransferase
Gene Symbol
Alternate Names
alpha-1,3/1,6-mannosyltransferase ALG2; alpha-1,3-mannosyltransferase ALG2; asparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog; asparagine-linked glycosylation 2 homolog (S. cerevisiae, alpha-1,3-mannosyltransferase);
Chromosome
5
Map Location
5q22

Proteins

alpha-1,3/1,6-mannosyltransferase ALG2
Refseq ID NP_001094180
Protein GI 213511844
UniProt ID Q3B8P6
mRNA ID NM_001100710
Length 415
MAENLYRTRSRVYSPSVLFLHPDMGIGGAERLVLDAALALQEYGCQVKIWTAHYDPNHCFIETRELSVQCAGDWLPRSLGWGGRGAAICSYVRMVFLALYVLFLSGEEFDVVVCDQVSACIPVFKLARRRKRVLFYCHFPDLLLTQRNSSLKKFYRAPIDWIEEYTTGMADRILVNSQYTASVFKETFKTLSHRNPDVLYPSLNIGSFDLAVPEKIDDLVPKGKQFLFLSINRYERKKNLPLALSSLVQLRARLPPQEWEKVHLFMAGGYDDRVLENVEHYKELKKIVQESDLERHVTFLRSFSDRQKISLLHGCLCVLYTPSNEHFGIVPLEAMYMQCPVIAVNSGGPLESIVHKVTGFLCEPDPVHFSEAMEKFIHKPSLKATMGLAGKARVAEKFSADAFADQLYQYVTKLV

Gene Information

Entrez Gene ID
Gene Name
ALG2, alpha-1,3/1,6-mannosyltransferase
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016020 IEA:Ensembl C membrane
GO:0005634 IEA:Ensembl C nucleus
GO:0048471 IEA:Ensembl C perinuclear region of cytoplasm
GO:0004378 IEA:InterPro F GDP-Man:Man1GlcNAc2-PP-Dol alpha-1,3-mannosyltransferase activity
GO:0000033 IEA:Ensembl F alpha-1,3-mannosyltransferase activity
GO:0033164 IEA:InterPro F glycolipid 6-alpha-mannosyltransferase activity
GO:0006488 IEA:Ensembl P dolichol-linked oligosaccharide biosynthetic process
GO:0033577 IEA:Ensembl P protein glycosylation in endoplasmic reticulum
GO:0051592 IEA:Ensembl P response to calcium ion

KEGG Pathway Links

KEGG Pathway ID Description
rno01100 Metabolic pathways
ko00510 N-Glycan biosynthesis
rno00510 N-Glycan biosynthesis
M00055 N-glycan precursor biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5953739 Asparagine N-linked glycosylation
5953738 Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
5953345 Metabolism of proteins
5953728 Post-translational protein modification

Domain Information

InterPro Annotations

Accession Description
IPR027054 ALG2
IPR001296 Glycosyl transferase, family 1

UniProt Annotations

Entry Information

Gene Name
ALG2, alpha-1,3/1,6-mannosyltransferase
Protein Entry
Q3B8P6_RAT
UniProt ID
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP013357 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
213511844 RefSeq NP_001094180 415 alpha-1,3/1,6-mannosyltransferase ALG2

Identical Sequences to LMP013357 proteins

Reference Database Accession Length Protein Name
GI:213511844 GenBank EDL78205.1 415 asparagine-linked glycosylation 2 homolog (yeast, alpha-1,3-mannosyltransferase), isoform CRA_a [Rattus norvegicus]
GI:213511844 GenBank EDL78206.1 415 asparagine-linked glycosylation 2 homolog (yeast, alpha-1,3-mannosyltransferase), isoform CRA_a [Rattus norvegicus]

Related Sequences to LMP013357 proteins

Reference Database Accession Length Protein Name
GI:213511844 DBBJ BAD11906.1 415 mannosyltransferase [Mus musculus]
GI:213511844 GenBank EDL78205.1 415 asparagine-linked glycosylation 2 homolog (yeast, alpha-1,3-mannosyltransferase), isoform CRA_a [Rattus norvegicus]
GI:213511844 GenBank EDL78206.1 415 asparagine-linked glycosylation 2 homolog (yeast, alpha-1,3-mannosyltransferase), isoform CRA_a [Rattus norvegicus]
GI:213511844 RefSeq NP_064382.3 415 alpha-1,3/1,6-mannosyltransferase ALG2 [Mus musculus]