Gene/Proteome Database (LMPD)
LMPD ID
LMP013357
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
ALG2, alpha-1,3/1,6-mannosyltransferase
Gene Symbol
Alternate Names
alpha-1,3/1,6-mannosyltransferase ALG2; alpha-1,3-mannosyltransferase ALG2; asparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog; asparagine-linked glycosylation 2 homolog (S. cerevisiae, alpha-1,3-mannosyltransferase);
Chromosome
5
Map Location
5q22
Proteins
| alpha-1,3/1,6-mannosyltransferase ALG2 | |
|---|---|
| Refseq ID | NP_001094180 |
| Protein GI | 213511844 |
| UniProt ID | Q3B8P6 |
| mRNA ID | NM_001100710 |
| Length | 415 |
| MAENLYRTRSRVYSPSVLFLHPDMGIGGAERLVLDAALALQEYGCQVKIWTAHYDPNHCFIETRELSVQCAGDWLPRSLGWGGRGAAICSYVRMVFLALYVLFLSGEEFDVVVCDQVSACIPVFKLARRRKRVLFYCHFPDLLLTQRNSSLKKFYRAPIDWIEEYTTGMADRILVNSQYTASVFKETFKTLSHRNPDVLYPSLNIGSFDLAVPEKIDDLVPKGKQFLFLSINRYERKKNLPLALSSLVQLRARLPPQEWEKVHLFMAGGYDDRVLENVEHYKELKKIVQESDLERHVTFLRSFSDRQKISLLHGCLCVLYTPSNEHFGIVPLEAMYMQCPVIAVNSGGPLESIVHKVTGFLCEPDPVHFSEAMEKFIHKPSLKATMGLAGKARVAEKFSADAFADQLYQYVTKLV | |
Gene Information
Entrez Gene ID
Gene Name
ALG2, alpha-1,3/1,6-mannosyltransferase
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016020 | IEA:Ensembl | C | membrane |
| GO:0005634 | IEA:Ensembl | C | nucleus |
| GO:0048471 | IEA:Ensembl | C | perinuclear region of cytoplasm |
| GO:0004378 | IEA:InterPro | F | GDP-Man:Man1GlcNAc2-PP-Dol alpha-1,3-mannosyltransferase activity |
| GO:0000033 | IEA:Ensembl | F | alpha-1,3-mannosyltransferase activity |
| GO:0033164 | IEA:InterPro | F | glycolipid 6-alpha-mannosyltransferase activity |
| GO:0006488 | IEA:Ensembl | P | dolichol-linked oligosaccharide biosynthetic process |
| GO:0033577 | IEA:Ensembl | P | protein glycosylation in endoplasmic reticulum |
| GO:0051592 | IEA:Ensembl | P | response to calcium ion |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| rno01100 | Metabolic pathways |
| ko00510 | N-Glycan biosynthesis |
| rno00510 | N-Glycan biosynthesis |
| M00055 | N-glycan precursor biosynthesis |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
ALG2, alpha-1,3/1,6-mannosyltransferase
Protein Entry
Q3B8P6_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP013357 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 213511844 | RefSeq | NP_001094180 | 415 | alpha-1,3/1,6-mannosyltransferase ALG2 |
Identical Sequences to LMP013357 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:213511844 | GenBank | EDL78205.1 | 415 | asparagine-linked glycosylation 2 homolog (yeast, alpha-1,3-mannosyltransferase), isoform CRA_a [Rattus norvegicus] |
| GI:213511844 | GenBank | EDL78206.1 | 415 | asparagine-linked glycosylation 2 homolog (yeast, alpha-1,3-mannosyltransferase), isoform CRA_a [Rattus norvegicus] |
Related Sequences to LMP013357 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:213511844 | DBBJ | BAD11906.1 | 415 | mannosyltransferase [Mus musculus] |
| GI:213511844 | GenBank | EDL78205.1 | 415 | asparagine-linked glycosylation 2 homolog (yeast, alpha-1,3-mannosyltransferase), isoform CRA_a [Rattus norvegicus] |
| GI:213511844 | GenBank | EDL78206.1 | 415 | asparagine-linked glycosylation 2 homolog (yeast, alpha-1,3-mannosyltransferase), isoform CRA_a [Rattus norvegicus] |
| GI:213511844 | RefSeq | NP_064382.3 | 415 | alpha-1,3/1,6-mannosyltransferase ALG2 [Mus musculus] |