Gene/Proteome Database (LMPD)
Proteins
membrane progestin receptor alpha | |
---|---|
Refseq ID | NP_001029253 |
Protein GI | 77539436 |
UniProt ID | Q4PU88 |
mRNA ID | NM_001034081 |
Length | 345 |
MAMAVAQKFSHLLSSLWHVGQKPLQAEPVFTVDRAEVPRLFWKPYIYAGYRPLHQNWCFYFRTLFQQHNEAVNVWTHLLAALALLLRLIVLAGSVDFWEDPHALPLFIIVLASFTYLSFSALAHLLQAKSEFWHYSFFFLDYVGVAVYQFGSALARFYYAIEPSWHDKVQAIFLPTAAFLAWLSCAGSCYNKYSQKPGLLGRSFQEVPSALAYALDISPVVHRIIVSPLPAEEDPALLYHKCQVVFFLLAAAFFSTVMPESWFPGSCHIFGQGHQVFHVFLVLCTLAQLEAVTLDYQARGAIYKPLHARWPHNFFGLFLLTVGSSILTALLLSQLVRRKLHQKTK |
Gene Information
Entrez Gene ID
Gene Name
progestin and adipoQ receptor family member VII
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:InterPro | C | integral component of membrane |
GO:0005886 | IBA:RefGenome | C | plasma membrane |
GO:0005496 | IBA:RefGenome | F | steroid binding |
GO:0003707 | IBA:RefGenome | F | steroid hormone receptor activity |
GO:0048545 | IBA:RefGenome | P | response to steroid hormone |
GO:0043401 | IBA:GOC | P | steroid hormone mediated signaling pathway |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR004254 | AdipoR/Haemolysin-III-related |
UniProt Annotations
Entry Information
Gene Name
progestin and adipoQ receptor family member VII
Protein Entry
Q4PU88_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP013362 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
77539436 | RefSeq | NP_001029253 | 345 | membrane progestin receptor alpha |
Identical Sequences to LMP013362 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:77539436 | GenBank | AAY67652.1 | 345 | progestin membrane receptor alpha [Rattus norvegicus] |
Related Sequences to LMP013362 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:77539436 | GenBank | AAY67652.1 | 345 | progestin membrane receptor alpha [Rattus norvegicus] |
GI:77539436 | GenBank | EDL80728.1 | 345 | rCG31200 [Rattus norvegicus] |
GI:77539436 | RefSeq | XP_006239192.1 | 345 | PREDICTED: membrane progestin receptor alpha isoform X1 [Rattus norvegicus] |
GI:77539436 | RefSeq | XP_008762367.1 | 359 | PREDICTED: membrane progestin receptor alpha isoform X2 [Rattus norvegicus] |