Gene/Proteome Database (LMPD)
Proteins
malonyl-CoA-acyl carrier protein transacylase, mitochondrial | |
---|---|
Refseq ID | NP_001178717 |
Protein GI | 300796456 |
UniProt ID | D3ZPF2 |
mRNA ID | NM_001191788 |
Length | 380 |
MNARVARACWAWGSWGRRPASSLREPPPDAVDVAGLLRDSSVTEEGVQEAVARRPPSRCSVLLFPGQGSQAVGMGGGLLHFPRVRQLYEAAHRVLGYDLLELCLRGPQEDLDRTVHCQPAVFVASLAAVEKLHHLQPAVIENCVAAAGFSVGEFAALVFAGAMEFAEGLYAVKVRAEAMQEASEAVPSGMLSVLGQRQSNFSFACLEAQEHCRSLGIENPVCQVSNYLFPDCRVISGHLEALQFLRKNSAKFHFRRTKMLPVSGGFHTCLMEPAVEPLMKTLGSINIKKPLVAVHSNVSGHKYTHPQHIRKLLGQQVVSPVKWEQTMHCIYERKKGMEFPSTFEVGPGQQLGSILKCCNRQAWKSYSHVDVMQTLLDPDH |
Gene Information
Entrez Gene ID
Gene Name
malonyl CoA:ACP acyltransferase (mitochondrial)
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005739 | IEA:Ensembl | C | mitochondrion |
GO:0004314 | IEA:Ensembl | F | [acyl-carrier-protein] S-malonyltransferase activity |
GO:0044822 | IEA:Ensembl | F | poly(A) RNA binding |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
malonyl CoA:ACP acyltransferase (mitochondrial)
Protein Entry
D3ZPF2_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP013383 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
300796456 | RefSeq | NP_001178717 | 380 | malonyl-CoA-acyl carrier protein transacylase, mitochondrial |
Identical Sequences to LMP013383 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:300796456 | RefSeq | XP_006242153.1 | 380 | PREDICTED: malonyl-CoA-acyl carrier protein transacylase, mitochondrial isoform X1 [Rattus norvegicus] |
Related Sequences to LMP013383 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:300796456 | GenBank | AAH99494.1 | 381 | Malonyl CoA:ACP acyltransferase (mitochondrial) [Mus musculus] |
GI:300796456 | RefSeq | NP_001025185.1 | 381 | malonyl-CoA-acyl carrier protein transacylase, mitochondrial [Mus musculus] |
GI:300796456 | RefSeq | XP_006242153.1 | 380 | PREDICTED: malonyl-CoA-acyl carrier protein transacylase, mitochondrial isoform X1 [Rattus norvegicus] |
GI:300796456 | SwissProt | Q8R3F5.3 | 381 | RecName: Full=Malonyl-CoA-acyl carrier protein transacylase, mitochondrial; Short=MCT; AltName: Full=Mitochondrial malonyltransferase; AltName: Full=[Acyl-carrier-protein] malonyltransferase; Flags: Precursor [Mus musculus] |