Gene/Proteome Database (LMPD)

LMPD ID
LMP013392
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
ELOVL fatty acid elongase 4
Gene Symbol
Alternate Names
elongation of very long chain fatty acids protein 4; elongation of very long chain fatty acids-like 4; elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 4;
Chromosome
8
Map Location
8q31
EC Number
2.3.1.199

Proteins

elongation of very long chain fatty acids protein 4
Refseq ID NP_001178725
Protein GI 300796614
UniProt ID D4ACH5
mRNA ID NM_001191796
Length 314
MGLLDSEPGSVLNAVSTAFNDTVEFYRWTWSIADKRVEDWPLMQSPWPTLSISTLYLLFVWLGPKWMKDREPFQMRLVLIIYNFGMVLLNLFIFRELFMGSYNAGYSYICQSVDYSNDVNEVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYHHCTMFTLWWIGIKWVAGGQAFFGAQMNSFIHVIMYSYYGLTAFGPWIQKYLWWKRYLTMLQLVQFHVTIGHTALSLYTDCPFPKWMHWALIAYAISFIFLFLNFYTRTYNEPKKSKTGKTATNGISANGVNKSEKQLVLENGKPQKNGKPKGE

Gene Information

Entrez Gene ID
Gene Name
ELOVL fatty acid elongase 4
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0030176 IEA:Ensembl C integral component of endoplasmic reticulum membrane
GO:0016740 IEA:UniProtKB-KW F transferase activity
GO:0019367 IEA:Ensembl P fatty acid elongation, saturated fatty acid

KEGG Pathway Links

KEGG Pathway ID Description
M00415 Fatty acid biosynthesis, elongation, endoplasmic reticulum
ko00062 Fatty acid elongation
rno00062 Fatty acid elongation

REACTOME Pathway Links

REACTOME Pathway ID Description
5953463 Fatty Acyl-CoA Biosynthesis
5953288 Fatty acid, triacylglycerol, and ketone body metabolism
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5953471 Synthesis of very long-chain fatty acyl-CoAs
5953464 Triglyceride Biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR002076 ELO family

UniProt Annotations

Entry Information

Gene Name
ELOVL fatty acid elongase 4
Protein Entry
D4ACH5_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2)
Similarity Belongs to the ELO family

Identical and Related Proteins

Unique RefSeq proteins for LMP013392 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
300796614 RefSeq NP_001178725 314 elongation of very long chain fatty acids protein 4

Identical Sequences to LMP013392 proteins

Reference Database Accession Length Protein Name
GI:300796614 GenBank EDL77659.1 314 elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 4 (predicted), isoform CRA_b [Rattus norvegicus]

Related Sequences to LMP013392 proteins

Reference Database Accession Length Protein Name
GI:300796614 GenBank EDL77659.1 314 elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 4 (predicted), isoform CRA_b [Rattus norvegicus]
GI:300796614 GenBank ERE76265.1 314 elongation of very long chain fatty acids protein 4 [Cricetulus griseus]
GI:300796614 RefSeq XP_003500033.1 314 PREDICTED: elongation of very long chain fatty acids protein 4 [Cricetulus griseus]
GI:300796614 RefSeq XP_007620171.1 314 PREDICTED: elongation of very long chain fatty acids protein 4 [Cricetulus griseus]