Gene/Proteome Database (LMPD)

LMPD ID
LMP013398
Gene ID
316122
Species
Rattus norvegicus (Rat)
Gene Name
abhydrolase domain containing 5
Gene Symbol
Abhd5
Synonyms
CGI-58;
Alternate Names
1-acylglycerol-3-phosphate O-acyltransferase ABHD5; lipid droplet-binding protein CGI-58; abhydrolase domain-containing protein 5;
Chromosome
8
Map Location
8q32
EC Number
2.3.1.51

Proteins

1-acylglycerol-3-phosphate O-acyltransferase ABHD5
Refseq ID NP_997689
Protein GI 47058978
UniProt ID Q6QA69
mRNA ID NM_212524
Length 351
MKAMAAEEEVDSADAGGGSGWLTGWLPTWCPTSTSHLKEAEEKMLKCVPCTYKKEPVRISNGNSIWTLMFSHNMSSKTPLVLLHGFGGGLGLWALNFEDLSTDRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALRLDKMILLGHNLGGFLAAAYSLKYPSRVSHLILVEPWGFPERPDLADQERPIPVWIRALGAALTPFNPLAGLRIAGPFGLSLVQRLRPDFKRKYSSMFEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRIGGLHPDIPVSVIFGARSCIDGNSGTSIQSLRPKSYVKTIAILGAGHYVYADQPEEFNQKVKEICHTVD

Gene Information

Entrez Gene ID
316122
Gene Name
abhydrolase domain containing 5
Gene Symbol
Abhd5
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 ISS:UniProtKB C cytosol
GO:0005811 ISS:UniProtKB C lipid particle
GO:0005634 IEA:Ensembl C nucleus
GO:0003841 IEA:UniProtKB-EC F 1-acylglycerol-3-phosphate O-acyltransferase activity
GO:0030154 IEA:UniProtKB-KW P cell differentiation
GO:0006631 IEA:UniProtKB-KW P fatty acid metabolic process
GO:0006629 IDA:MGI P lipid metabolic process
GO:0010891 ISS:UniProtKB P negative regulation of sequestering of triglyceride
GO:0006654 ISS:UniProtKB P phosphatidic acid biosynthetic process
GO:0051006 IEA:Ensembl P positive regulation of lipoprotein lipase activity
GO:0010898 ISS:UniProtKB P positive regulation of triglyceride catabolic process

REACTOME Pathway Links

REACTOME Pathway ID Description
5953753 Hormone-sensitive lipase (HSL)-mediated triacylglycerol hydrolysis
5953754 Lipid digestion, mobilization, and transport
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins

Domain Information

InterPro Annotations

Accession Description
IPR029058 Alpha/Beta hydrolase fold
IPR000073 Alpha/beta hydrolase fold-1

UniProt Annotations

Entry Information

Gene Name
abhydrolase domain containing 5
Protein Entry
ABHD5_RAT
UniProt ID
Q6QA69
Species
Rat

Comments

Comment Type Description
Catalytic Activity Acyl-CoA + 1-acyl-sn-glycerol 3-phosphate = CoA + 1,2-diacyl-sn-glycerol 3-phosphate.
Domain The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate.
Function Lysophosphatidic acid acyltransferase which functions in phosphatidic acid biosynthesis. May regulate the cellular storage of triacylglycerol through activation of the phospholipase PNPLA2. Involved in keratinocyte differentiation (By similarity)
Induction Increased in the early stage of adipocyte differentiation
Similarity Belongs to the peptidase S33 family. ABHD4/ABHD5 subfamily
Subcellular Location Cytoplasm . Lipid droplet . Note=Colocalized with PLIN and ADRP on the surface of lipid droplets. The localization is dependent upon the metabolic status of the adipocytes and the activity of PKA.
Subunit Interacts with ADRP and PLIN. Interacts with PNPLA2 (By similarity). Interacts with PLIN5; promotes interaction with PNPLA2. {ECO:0000250, ECO:0000269|PubMed:15136565, ECO:0000269|PubMed:23408028}.

Identical and Related Proteins

Unique RefSeq proteins for LMP013398 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
47058978 RefSeq NP_997689 351 1-acylglycerol-3-phosphate O-acyltransferase ABHD5

Identical Sequences to LMP013398 proteins

Reference Database Accession Length Protein Name
GI:47058978 GenBank AAS57860.1 351 CGI-58-like protein [Rattus norvegicus]
GI:47058978 GenBank EDL76799.1 351 CGI-58-like protein, isoform CRA_a [Rattus norvegicus]
GI:47058978 SwissProt Q6QA69.1 351 RecName: Full=1-acylglycerol-3-phosphate O-acyltransferase ABHD5; AltName: Full=Abhydrolase domain-containing protein 5; AltName: Full=Lipid droplet-binding protein CGI-58; Short=Protein CGI-58 [Rattus norvegicus]

Related Sequences to LMP013398 proteins

Reference Database Accession Length Protein Name
GI:47058978 GenBank AAS57860.1 351 CGI-58-like protein [Rattus norvegicus]
GI:47058978 GenBank AAI27471.1 375 Abhd5 protein, partial [Rattus norvegicus]
GI:47058978 GenBank EDL76799.1 351 CGI-58-like protein, isoform CRA_a [Rattus norvegicus]
GI:47058978 SwissProt Q6QA69.1 351 RecName: Full=1-acylglycerol-3-phosphate O-acyltransferase ABHD5; AltName: Full=Abhydrolase domain-containing protein 5; AltName: Full=Lipid droplet-binding protein CGI-58; Short=Protein CGI-58 [Rattus norvegicus]