Gene/Proteome Database (LMPD)
Proteins
| membrane progestin receptor beta | |
|---|---|
| Refseq ID | NP_001014121 |
| Protein GI | 62078931 |
| UniProt ID | Q6AY03 |
| mRNA ID | NM_001014099 |
| Length | 354 |
| MTTAILERLSTLSVSGQQLRRLPKILEEGLPKMPCTVPETDVPQLFREPYIHAGYRPTGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFVEAGALQWASPHTLPLLLFILSSITYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYERFWLFFLPAAAFCGWLSCAGCCYAKYRYRRPYPVMRKICQVVPAGLAFILDISPVAHRVALCHLAGCQEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAILLDYQGRHEIFFQRHGPLSVYTACLSFFFLAACSAATASLLRHKVKDRLIKKDS | |
Gene Information
Entrez Gene ID
Gene Name
progestin and adipoQ receptor family member VIII
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:InterPro | C | integral component of membrane |
| GO:0005886 | IBA:RefGenome | C | plasma membrane |
| GO:0005496 | IBA:RefGenome | F | steroid binding |
| GO:0003707 | IBA:RefGenome | F | steroid hormone receptor activity |
| GO:0048545 | IBA:RefGenome | P | response to steroid hormone |
| GO:0043401 | IBA:GOC | P | steroid hormone mediated signaling pathway |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR004254 | AdipoR/Haemolysin-III-related |
UniProt Annotations
Entry Information
Gene Name
progestin and adipoQ receptor family member VIII
Protein Entry
Q6AY03_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP013399 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 62078931 | RefSeq | NP_001014121 | 354 | membrane progestin receptor beta |
Identical Sequences to LMP013399 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:62078931 | GenBank | AAH79247.1 | 354 | Progestin and adipoQ receptor family member VIII [Rattus norvegicus] |
| GI:62078931 | GenBank | AAY89125.1 | 354 | progestin membrane receptor beta [Rattus norvegicus] |
| GI:62078931 | GenBank | EDM18645.1 | 354 | similar to putative membrane steroid receptor, isoform CRA_a [Rattus norvegicus] |
| GI:62078931 | GenBank | EDM18646.1 | 354 | similar to putative membrane steroid receptor, isoform CRA_a [Rattus norvegicus] |
Related Sequences to LMP013399 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:62078931 | GenBank | AAH79247.1 | 354 | Progestin and adipoQ receptor family member VIII [Rattus norvegicus] |
| GI:62078931 | GenBank | AAY89125.1 | 354 | progestin membrane receptor beta [Rattus norvegicus] |
| GI:62078931 | GenBank | EDM18645.1 | 354 | similar to putative membrane steroid receptor, isoform CRA_a [Rattus norvegicus] |
| GI:62078931 | GenBank | EDM18646.1 | 354 | similar to putative membrane steroid receptor, isoform CRA_a [Rattus norvegicus] |