Gene/Proteome Database (LMPD)
LMPD ID
LMP013416
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
retinol dehydrogenase 7
Gene Symbol
Synonyms
Rdh3; RoDH(III); RGD1307178;
Alternate Names
retinol dehydrogenase 7; RODH I; RODH III; retinol dehydrogenase 3; retinol dehydrogenase type III; hypothetical gene supported by NM_133543;
Chromosome
7
Map Location
7q22
EC Number
1.1.1.105
Summary
catalyzes the first step in retinoic acid biogenesis [RGD, Feb 2006]
Orthologs
Proteins
retinol dehydrogenase 7 precursor | |
---|---|
Refseq ID | NP_598227 |
Protein GI | 58585242 |
UniProt ID | P55006 |
mRNA ID | NM_133543 |
Length | 317 |
MWLYLLALVGLWNLLRLFRERKVVSHLQDKYVFITGCDSGFGNLLARQLDRRGMRVLAACLTEKGAEQLRSKTSDRLETVILDVTKTESIVAATQWVKERVGNRGLWGLVNNAGISVPMGPNEWMRKKDFASVLDVNLLGVIEVTLNMLPLVRKARGRVVNIASTMGRMSLLGGGYCISKYGVEAFSDSLRRELTYFGVKVAIIEPGGFKTNVTNMERLSDNLKKLWDQATEEVKEIYGEKFRDSYMKAMESLVNMCSGDLSLVTDCMEHALTSCHPRTRYSAGWDAKFFYLPMSYLPTFLSDAVIYWGSVKPARAL | |
sig_peptide: 1..17 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2088 peptide sequence: MWLYLLALVGLWNLLRL |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
GO:0004745 | IEA:UniProtKB-EC | F | retinol dehydrogenase activity |
GO:0042572 | IEA:UniProtKB-UniPathway | P | retinol metabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | All-trans-retinol-[cellular-retinol-binding- protein] + NAD(+) = all-trans-retinal-[cellular-retinol-binding- protein] + NADH. |
Function | Acts on retinol bound on cellular retinol-binding protein (CRBP). |
Pathway | Cofactor metabolism; retinol metabolism. |
Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family |
Subcellular Location | Microsome. Endoplasmic reticulum . |
Identical and Related Proteins
Unique RefSeq proteins for LMP013416 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
58585242 | RefSeq | NP_598227 | 317 | retinol dehydrogenase 7 precursor |
Identical Sequences to LMP013416 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:58585242 | GenBank | AAH88090.1 | 317 | Retinol dehydrogenase 7 [Rattus norvegicus] |
GI:58585242 | GenBank | AAH98650.1 | 317 | Retinol dehydrogenase 7 [Rattus norvegicus] |
GI:58585242 | GenBank | EDM16445.1 | 317 | rCG60224 [Rattus norvegicus] |
GI:58585242 | SwissProt | P55006.1 | 317 | RecName: Full=Retinol dehydrogenase 7; AltName: Full=Retinol dehydrogenase type III; Short=RODH III [Rattus norvegicus] |
Related Sequences to LMP013416 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:58585242 | GenBank | AAH88090.1 | 317 | Retinol dehydrogenase 7 [Rattus norvegicus] |
GI:58585242 | GenBank | AAH98650.1 | 317 | Retinol dehydrogenase 7 [Rattus norvegicus] |
GI:58585242 | GenBank | EDM16445.1 | 317 | rCG60224 [Rattus norvegicus] |
GI:58585242 | SwissProt | P55006.1 | 317 | RecName: Full=Retinol dehydrogenase 7; AltName: Full=Retinol dehydrogenase type III; Short=RODH III [Rattus norvegicus] |