Gene/Proteome Database (LMPD)

LMPD ID
LMP013465
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
ALG14, UDP-N-acetylglucosaminyltransferase subunit
Gene Symbol
Synonyms
RGD1312003;
Alternate Names
UDP-N-acetylglucosamine transferase subunit ALG14 homolog; asparagine-linked glycosylation 14 homolog;
Chromosome
2
Map Location
2q41

Proteins

UDP-N-acetylglucosamine transferase subunit ALG14 homolog
Refseq ID NP_001014198
Protein GI 62079077
UniProt ID Q6AY85
mRNA ID NM_001014176
Length 216
MVCVLTLAASAGGLAVLLIVRLWAVLRSHPVTPRQSLGLLIVAGSGGHTAEILRLVGSLSGAYSPRHYVIAESDEMSAKKIHSLELARAQNDSTTEHTEYYLHRIPRSREVRQSWLSSVFTTLYSIWFSFPLVHRIKPDLVLCNGPGTCVPICVSALLLGILGIKKVIIVYVESICRVETLSLSGKILWHLSDYFIVQWPTLKEKYPKSVYLGRIV

Gene Information

Entrez Gene ID
Gene Name
ALG14, UDP-N-acetylglucosaminyltransferase subunit
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane

KEGG Pathway Links

KEGG Pathway ID Description
rno01100 Metabolic pathways
ko00510 N-Glycan biosynthesis
rno00510 N-Glycan biosynthesis
M00055 N-glycan precursor biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5953739 Asparagine N-linked glycosylation
5953738 Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
5953345 Metabolism of proteins
5953728 Post-translational protein modification

Domain Information

InterPro Annotations

Accession Description
IPR013969 Oligosaccharide biosynthesis protein Alg14-like

UniProt Annotations

Entry Information

Gene Name
ALG14, UDP-N-acetylglucosaminyltransferase subunit
Protein Entry
ALG14_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Function Involved in protein N-glycosylation. Essential for the second step of the dolichol-linked oligosaccharide pathway. Anchors the catalytic subunit ALG13 to the ER (By similarity)
Similarity Belongs to the ALG14 family
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Single-pass membrane protein .
Subunit Heterodimer with ALG13 to form a functional enzyme

Identical and Related Proteins

Unique RefSeq proteins for LMP013465 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
62079077 RefSeq NP_001014198 216 UDP-N-acetylglucosamine transferase subunit ALG14 homolog

Identical Sequences to LMP013465 proteins

Reference Database Accession Length Protein Name
GI:62079077 GenBank AAH79151.1 216 Asparagine-linked glycosylation 14 homolog (S. cerevisiae) [Rattus norvegicus]
GI:62079077 GenBank EDL82072.1 216 rCG28866, isoform CRA_a [Rattus norvegicus]
GI:62079077 SwissProt Q6AY85.1 216 RecName: Full=UDP-N-acetylglucosamine transferase subunit ALG14 homolog [Rattus norvegicus]

Related Sequences to LMP013465 proteins

Reference Database Accession Length Protein Name
GI:62079077 GenBank AAH79151.1 216 Asparagine-linked glycosylation 14 homolog (S. cerevisiae) [Rattus norvegicus]
GI:62079077 GenBank EDL12344.1 217 asparagine-linked glycosylation 14 homolog (yeast), isoform CRA_b [Mus musculus]
GI:62079077 GenBank EDL82072.1 216 rCG28866, isoform CRA_a [Rattus norvegicus]
GI:62079077 SwissProt Q6AY85.1 216 RecName: Full=UDP-N-acetylglucosamine transferase subunit ALG14 homolog [Rattus norvegicus]