Gene/Proteome Database (LMPD)
Proteins
reticulocalbin-1 precursor | |
---|---|
Refseq ID | NP_001102056 |
Protein GI | 157819753 |
UniProt ID | D3ZUB0 |
mRNA ID | NM_001108586 |
Length | 325 |
MARGGRLGLALGLLLALVLALRAKPTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLSPDESKERLGKIVDRIDSDGDGLVTTEELKVWIKRVQKRYIYDNVAKVWKDYDRDKDEKISWEEYKQATYGYYLGNPAEFQDSSDHHTFKKMLPRDERRFKASDLDGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEDNGPEPDWVLSEREQFNDFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEMLTKEEILDNWNMFVGSQATNYGEDLTKNHDEL | |
sig_peptide: 1..23 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2319 peptide sequence: MARGGRLGLALGLLLALVLALRA |
Gene Information
Entrez Gene ID
Gene Name
reticulocalbin 1, EF-hand calcium binding domain
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:Ensembl | C | endoplasmic reticulum |
GO:0005509 | IEA:InterPro | F | calcium ion binding |
GO:0043010 | IEA:Ensembl | P | camera-type eye development |
GO:0001701 | IEA:Ensembl | P | in utero embryonic development |
Domain Information
UniProt Annotations
Entry Information
Gene Name
reticulocalbin 1, EF-hand calcium binding domain
Protein Entry
D3ZUB0_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP013469 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
157819753 | RefSeq | NP_001102056 | 325 | reticulocalbin-1 precursor |
Identical Sequences to LMP013469 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:157819753 | GenBank | EDL79716.1 | 325 | reticulocalbin 1 (predicted), isoform CRA_a [Rattus norvegicus] |
Related Sequences to LMP013469 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:157819753 | DBBJ | BAE35525.1 | 325 | unnamed protein product [Mus musculus] |
GI:157819753 | GenBank | AAE60889.1 | 325 | Sequence 4 from patent US 6194385 |
GI:157819753 | GenBank | AAH49108.1 | 325 | Reticulocalbin 1 [Mus musculus] |
GI:157819753 | GenBank | EDL79716.1 | 325 | reticulocalbin 1 (predicted), isoform CRA_a [Rattus norvegicus] |