Gene/Proteome Database (LMPD)
LMPD ID
LMP013484
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
family with sequence similarity 213, member B
Gene Symbol
Synonyms
RGD1308251;
Alternate Names
prostamide/prostaglandin F synthase; prostamide/PGF synthase; prostamide/PG F synthase;
Chromosome
5
Map Location
5q36
EC Number
1.11.1.20;
Proteins
prostamide/prostaglandin F synthase | |
---|---|
Refseq ID | NP_001102167 |
Protein GI | 157822867 |
UniProt ID | D3ZVR7 |
mRNA ID | NM_001108697 |
Length | 201 |
MSTLDLGRVGACVLKHAVTGEAVELRSLWQEKACVVAGLRRFGCMVCRWIAQDLSNLRGILDQNDVRLVGIGPEALGLQEFLDGGYFSGELYLDESKQIYKELGFKRYNSLSILPAALGKPVRDVASKAKAVGIQGNLSGDLLQSGGLLVVSKGGDRVLLHFIQSSPGDYVPQENILQALGISAEVCSSKPPQCDEEVCGR |
Gene Information
Entrez Gene ID
Gene Name
family with sequence similarity 213, member B
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005737 | ISS:UniProt | C | cytoplasm |
GO:0005829 | IEA:Ensembl | C | cytosol |
GO:0005783 | ISS:UniProt | C | endoplasmic reticulum |
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0043209 | IDA:UniProt | C | myelin sheath |
GO:0016616 | ISS:UniProtKB | F | oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor |
GO:0047017 | ISS:UniProt | F | prostaglandin-F synthase activity |
GO:0001516 | ISS:UniProtKB | P | prostaglandin biosynthetic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko00590 | Arachidonic acid metabolism |
rno00590 | Arachidonic acid metabolism |
rno01100 | Metabolic pathways |
REACTOME Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR012336 | Thioredoxin-like fold |
UniProt Annotations
Entry Information
Gene Name
family with sequence similarity 213, member B
Protein Entry
PGFS_RAT
UniProt ID
Species
Rat
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Thioredoxin + prostaglandin H(2) = thioredoxin disulfide + prostaglandin F(2-alpha). |
Function | Catalyzes the reduction of prostaglandin-ethanolamide H(2) (prostamide H(2)) to prostamide F(2alpha) with NADPH as proton donor. Also able to reduce prostaglandin H(2) to prostaglandin F(2alpha) (By similarity) |
Similarity | Belongs to the peroxiredoxin-like FAM213 family. Prostamide/prostaglandin F synthase subfamily |
Subcellular Location | Cytoplasm, cytosol . |
Identical and Related Proteins
Unique RefSeq proteins for LMP013484 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
157822867 | RefSeq | NP_001102167 | 201 | prostamide/prostaglandin F synthase |
Identical Sequences to LMP013484 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:157822867 | GenBank | EDL81278.1 | 201 | similar to RIKEN cDNA 2810405K02 (predicted) [Rattus norvegicus] |
GI:157822867 | SwissProt | D3ZVR7.1 | 201 | RecName: Full=Prostamide/prostaglandin F synthase; Short=Prostamide/PG F synthase; Short=Prostamide/PGF synthase [Rattus norvegicus] |
Related Sequences to LMP013484 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:157822867 | GenBank | AAH30453.1 | 201 | RIKEN cDNA 2810405K02 gene [Mus musculus] |
GI:157822867 | GenBank | EDL81278.1 | 201 | similar to RIKEN cDNA 2810405K02 (predicted) [Rattus norvegicus] |
GI:157822867 | SwissProt | Q9DB60.1 | 201 | RecName: Full=Prostamide/prostaglandin F synthase; Short=Prostamide/PG F synthase; Short=Prostamide/PGF synthase [Mus musculus] |
GI:157822867 | SwissProt | D3ZVR7.1 | 201 | RecName: Full=Prostamide/prostaglandin F synthase; Short=Prostamide/PG F synthase; Short=Prostamide/PGF synthase [Rattus norvegicus] |