Gene/Proteome Database (LMPD)
LMPD ID
LMP013497
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Gene Symbol
Synonyms
siat4c;
Alternate Names
CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4; SIAT4-C; ST3GalIV; ST3Gal IV; alpha 2,3-ST 4; sialyltransferase 4C; alpha 2,3-sialyltransferase IV; alpha-2,3-sialyltransferase ST3Gal IV; beta-galactoside alpha-2,3-sialyltransferase 4; gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase;
Chromosome
8
Map Location
8q21
EC Number
2.4.99.-
Summary
plasma membrane-specific alpha 2,3- sialic acid transporter; may be important for protein amino acid glycosylation [RGD, Feb 2006]
Orthologs
Proteins
CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 | |
---|---|
Refseq ID | NP_976082 |
Protein GI | 42627873 |
UniProt ID | P61131 |
mRNA ID | NM_203337 |
Length | 333 |
MTSKSHWKLLALALVLVVVMVWYSISREDRYIEFFYFPVSEKKEPCFQGEAERQASKIFGNHSREQPIFLQLKDYFWVKTPSAYELPFGTKGSEDLLLRVLAITSYSIPESIQSLECRRCVVVGNGHRLKNSSLGGVINKYDVVIRLNNAPVAGYEGDVGSKTTIRLFYPESAHFDPKIENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIAADKLLSLPIQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMAGSGHNVSQEAVAIKRMLEMGAVKNLTYF |
Gene Information
Entrez Gene ID
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0030173 | IEA:InterPro | C | integral component of Golgi membrane |
GO:0003836 | IEA:Ensembl | F | beta-galactoside (CMP) alpha-2,3-sialyltransferase activity |
GO:0047288 | IDA:RGD | F | monosialoganglioside sialyltransferase activity |
GO:0050890 | IEA:Ensembl | P | cognition |
GO:0006486 | IEA:UniProtKB-UniPathway | P | protein glycosylation |
GO:0097503 | IDA:GOC | P | sialylation |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko00601 | Glycosphingolipid biosynthesis - lacto and neolacto series |
rno00601 | Glycosphingolipid biosynthesis - lacto and neolacto series |
rno01100 | Metabolic pathways |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5953739 | Asparagine N-linked glycosylation |
5953738 | Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein |
5953253 | Disease |
5953252 | Glycogen storage diseases |
5953861 | Glycosaminoglycan metabolism |
5954344 | Keratan sulfate biosynthesis |
5954345 | Keratan sulfate/keratin metabolism |
5953250 | Metabolism |
5953249 | Metabolism of carbohydrates |
5953345 | Metabolism of proteins |
5953870 | MPS I - Hurler syndrome |
5953869 | MPS II - Hunter syndrome |
5953872 | MPS IIIA - Sanfilippo syndrome A |
5953864 | MPS IIIB - Sanfilippo syndrome B |
5953867 | MPS IIIC - Sanfilippo syndrome C |
5953871 | MPS IIID - Sanfilippo syndrome D |
5953866 | MPS IV - Morquio syndrome A |
5953873 | MPS IV - Morquio syndrome B |
5953862 | MPS IX - Natowicz syndrome |
5953868 | MPS VII - Sly syndrome |
5953865 | MPS VI - Maroteaux-Lamy syndrome |
5953863 | Mucopolysaccharidoses |
5953251 | Myoclonic epilepsy of Lafora |
5954395 | N-Glycan antennae elongation |
5954394 | N-glycan antennae elongation in the medial/trans-Golgi |
5954369 | O-linked glycosylation |
5954368 | O-linked glycosylation of mucins |
5953728 | Post-translational protein modification |
5954523 | Pre-NOTCH Expression and Processing |
5954524 | Pre-NOTCH Processing in Golgi |
5954270 | Sialic acid metabolism |
5953700 | Signaling by NOTCH |
5953381 | Signal Transduction |
5953737 | Synthesis of substrates in N-glycan biosythesis |
5954401 | Termination of O-glycan biosynthesis |
5954050 | Transport to the Golgi and subsequent modification |
Domain Information
UniProt Annotations
Entry Information
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Protein Entry
SIA4C_RAT
UniProt ID
Species
Rat
Comments
Comment Type | Description |
---|---|
Catalytic Activity | CMP-N-acetylneuraminate + beta-D-galactosyl- 1,4-N-acetyl-D-glucosaminyl-glycoprotein = CMP + alpha-N- acetylneuraminyl-2,3-beta-D-galactosyl-1,4-N-acetyl-D- glucosaminyl-glycoprotein. |
Function | It may catalyze the formation of the NeuAc-alpha-2,3- Gal-beta-1,3-GalNAc- or NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids |
Pathway | Protein modification; protein glycosylation. |
Similarity | Belongs to the glycosyltransferase 29 family |
Subcellular Location | Golgi apparatus, Golgi stack membrane {ECO:0000250}; Single-pass type II membrane protein . Note=Membrane-bound form in trans cisternae of Golgi |
Identical and Related Proteins
Unique RefSeq proteins for LMP013497 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
42627873 | RefSeq | NP_976082 | 333 | CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 |
Identical Sequences to LMP013497 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:42627873 | GenBank | AAH89057.1 | 333 | ST3 beta-galactoside alpha-2,3-sialyltransferase 4 [Rattus norvegicus] |
GI:42627873 | RefSeq | XP_006242851.1 | 333 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X1 [Rattus norvegicus] |
GI:42627873 | RefSeq | XP_008764282.1 | 333 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X1 [Rattus norvegicus] |
GI:42627873 | SwissProt | P61131.1 | 333 | RecName: Full=CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4; Short=Alpha 2,3-ST 4; Short=Beta-galactoside alpha-2,3-sialyltransferase 4; AltName: Full=Alpha 2,3-sialyltransferase IV; AltName: Full=Gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase; AltName: Full=ST3Gal IV; Short=ST3GalIV; AltName: Full=Sialyltransferase 4C; Short=SIAT4-C [Rattus norvegicus] |
Related Sequences to LMP013497 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:42627873 | EMBL | CAF25183.1 | 333 | alpha-2,3-sialyltransferase ST3Gal IV [Rattus norvegicus] |
GI:42627873 | GenBank | AAH89057.1 | 333 | ST3 beta-galactoside alpha-2,3-sialyltransferase 4 [Rattus norvegicus] |
GI:42627873 | RefSeq | XP_008764282.1 | 333 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X1 [Rattus norvegicus] |
GI:42627873 | SwissProt | P61131.1 | 333 | RecName: Full=CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4; Short=Alpha 2,3-ST 4; Short=Beta-galactoside alpha-2,3-sialyltransferase 4; AltName: Full=Alpha 2,3-sialyltransferase IV; AltName: Full=Gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase; AltName: Full=ST3Gal IV; Short=ST3GalIV; AltName: Full=Sialyltransferase 4C; Short=SIAT4-C [Rattus norvegicus] |