Gene/Proteome Database (LMPD)

LMPD ID
LMP013497
Gene ID
363040
Species
Rattus norvegicus (Rat)
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Gene Symbol
St3gal4
Synonyms
siat4c;
Alternate Names
CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4; SIAT4-C; ST3GalIV; ST3Gal IV; alpha 2,3-ST 4; sialyltransferase 4C; alpha 2,3-sialyltransferase IV; alpha-2,3-sialyltransferase ST3Gal IV; beta-galactoside alpha-2,3-sialyltransferase 4; gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase;
Chromosome
8
Map Location
8q21
EC Number
2.4.99.-
Summary
plasma membrane-specific alpha 2,3- sialic acid transporter; may be important for protein amino acid glycosylation [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for St3gal4

Proteins

CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4
Refseq ID NP_976082
Protein GI 42627873
UniProt ID P61131
mRNA ID NM_203337
Length 333
MTSKSHWKLLALALVLVVVMVWYSISREDRYIEFFYFPVSEKKEPCFQGEAERQASKIFGNHSREQPIFLQLKDYFWVKTPSAYELPFGTKGSEDLLLRVLAITSYSIPESIQSLECRRCVVVGNGHRLKNSSLGGVINKYDVVIRLNNAPVAGYEGDVGSKTTIRLFYPESAHFDPKIENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIAADKLLSLPIQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMAGSGHNVSQEAVAIKRMLEMGAVKNLTYF

Gene Information

Entrez Gene ID
363040
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Gene Symbol
St3gal4
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0030173 IEA:InterPro C integral component of Golgi membrane
GO:0003836 IEA:Ensembl F beta-galactoside (CMP) alpha-2,3-sialyltransferase activity
GO:0047288 IDA:RGD F monosialoganglioside sialyltransferase activity
GO:0050890 IEA:Ensembl P cognition
GO:0006486 IEA:UniProtKB-UniPathway P protein glycosylation
GO:0097503 IDA:GOC P sialylation

KEGG Pathway Links

KEGG Pathway ID Description
ko00601 Glycosphingolipid biosynthesis - lacto and neolacto series
rno00601 Glycosphingolipid biosynthesis - lacto and neolacto series
rno01100 Metabolic pathways

REACTOME Pathway Links

REACTOME Pathway ID Description
5953739 Asparagine N-linked glycosylation
5953738 Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
5953253 Disease
5953252 Glycogen storage diseases
5953861 Glycosaminoglycan metabolism
5954344 Keratan sulfate biosynthesis
5954345 Keratan sulfate/keratin metabolism
5953870 MPS I - Hurler syndrome
5953869 MPS II - Hunter syndrome
5953872 MPS IIIA - Sanfilippo syndrome A
5953864 MPS IIIB - Sanfilippo syndrome B
5953867 MPS IIIC - Sanfilippo syndrome C
5953871 MPS IIID - Sanfilippo syndrome D
5953866 MPS IV - Morquio syndrome A
5953873 MPS IV - Morquio syndrome B
5953862 MPS IX - Natowicz syndrome
5953865 MPS VI - Maroteaux-Lamy syndrome
5953868 MPS VII - Sly syndrome
5953250 Metabolism
5953249 Metabolism of carbohydrates
5953345 Metabolism of proteins
5953863 Mucopolysaccharidoses
5953251 Myoclonic epilepsy of Lafora
5954395 N-Glycan antennae elongation
5954394 N-glycan antennae elongation in the medial/trans-Golgi
5954369 O-linked glycosylation
5954368 O-linked glycosylation of mucins
5953728 Post-translational protein modification
5954523 Pre-NOTCH Expression and Processing
5954524 Pre-NOTCH Processing in Golgi
5954270 Sialic acid metabolism
5953381 Signal Transduction
5953700 Signaling by NOTCH
5953737 Synthesis of substrates in N-glycan biosythesis
5954401 Termination of O-glycan biosynthesis
5954050 Transport to the Golgi and subsequent modification

Domain Information

InterPro Annotations

Accession Description
IPR001675 Glycosyl transferase, family 29
IPR012163 Sialyltransferase

UniProt Annotations

Entry Information

Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Protein Entry
SIA4C_RAT
UniProt ID
P61131
Species
Rat

Comments

Comment Type Description
Catalytic Activity CMP-N-acetylneuraminate + beta-D-galactosyl- 1,4-N-acetyl-D-glucosaminyl-glycoprotein = CMP + alpha-N- acetylneuraminyl-2,3-beta-D-galactosyl-1,4-N-acetyl-D- glucosaminyl-glycoprotein.
Function It may catalyze the formation of the NeuAc-alpha-2,3- Gal-beta-1,3-GalNAc- or NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the glycosyltransferase 29 family
Subcellular Location Golgi apparatus, Golgi stack membrane {ECO:0000250}; Single-pass type II membrane protein . Note=Membrane-bound form in trans cisternae of Golgi

Identical and Related Proteins

Unique RefSeq proteins for LMP013497 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
42627873 RefSeq NP_976082 333 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4

Identical Sequences to LMP013497 proteins

Reference Database Accession Length Protein Name
GI:42627873 GenBank AAH89057.1 333 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 [Rattus norvegicus]
GI:42627873 RefSeq XP_006242851.1 333 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X1 [Rattus norvegicus]
GI:42627873 RefSeq XP_008764282.1 333 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X1 [Rattus norvegicus]
GI:42627873 SwissProt P61131.1 333 RecName: Full=CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4; Short=Alpha 2,3-ST 4; Short=Beta-galactoside alpha-2,3-sialyltransferase 4; AltName: Full=Alpha 2,3-sialyltransferase IV; AltName: Full=Gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase; AltName: Full=ST3Gal IV; Short=ST3GalIV; AltName: Full=Sialyltransferase 4C; Short=SIAT4-C [Rattus norvegicus]

Related Sequences to LMP013497 proteins

Reference Database Accession Length Protein Name
GI:42627873 EMBL CAF25183.1 333 alpha-2,3-sialyltransferase ST3Gal IV [Rattus norvegicus]
GI:42627873 GenBank AAH89057.1 333 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 [Rattus norvegicus]
GI:42627873 RefSeq XP_008764282.1 333 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X1 [Rattus norvegicus]
GI:42627873 SwissProt P61131.1 333 RecName: Full=CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4; Short=Alpha 2,3-ST 4; Short=Beta-galactoside alpha-2,3-sialyltransferase 4; AltName: Full=Alpha 2,3-sialyltransferase IV; AltName: Full=Gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase; AltName: Full=ST3Gal IV; Short=ST3GalIV; AltName: Full=Sialyltransferase 4C; Short=SIAT4-C [Rattus norvegicus]