Gene/Proteome Database (LMPD)
LMPD ID
LMP013508
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
tafazzin
Gene Symbol
Alternate Names
tafazzin; Barth syndrome); endocardial fibroelastosis 2; cardiomyopathy, dilated 3A (X-linked); tafazzin (cardiomyopathy, dilated 3A (X-linked); tafazzin (cardiomyopathy, dilated 3A (X-linked); endocardial fibroelastosis 2; Barth syndrome);
Chromosome
X
Map Location
chromosome:X
Summary
human homolog may play a role in cardiolipin metabolism [RGD, Feb 2006]
Orthologs
Proteins
tafazzin | |
---|---|
Refseq ID | NP_001020919 |
Protein GI | 71043828 |
UniProt ID | Q4KLG6 |
mRNA ID | NM_001025748 |
Length | 262 |
MPLHVKWPFPAVPRLTWTLASSVVMGLVGTYSCFWTKYMNHLTVYNKEVLYELIENRGPATPLITVSNHQSCMDDPHLWGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGDGVYQKGMDFILEKLNHGDWVHIFPEGKVNMSSEFLRFKWGIGRLIAECHLNPIILPLWHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSTLPVLERLRAENKSAVEMRKALTDFIQEEFQRLKMQAEQLHNHFQPGR |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005829 | IEA:Ensembl | C | cytosol |
GO:0016020 | IEA:Ensembl | C | membrane |
GO:0005739 | IEA:Ensembl | C | mitochondrion |
GO:0005634 | IEA:Ensembl | C | nucleus |
GO:0047184 | IEA:Ensembl | F | 1-acylglycerophosphocholine O-acyltransferase activity |
GO:0060048 | IEA:Ensembl | P | cardiac muscle contraction |
GO:0048738 | IEA:Ensembl | P | cardiac muscle tissue development |
GO:0032049 | IEA:Ensembl | P | cardiolipin biosynthetic process |
GO:0042407 | IEA:Ensembl | P | cristae formation |
GO:0030097 | IEA:Ensembl | P | hemopoiesis |
GO:0042775 | IEA:Ensembl | P | mitochondrial ATP synthesis coupled electron transport |
GO:0032981 | IEA:Ensembl | P | mitochondrial respiratory chain complex I assembly |
GO:0007519 | IEA:Ensembl | P | skeletal muscle tissue development |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko00564 | Glycerophospholipid metabolism |
rno00564 | Glycerophospholipid metabolism |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP013508 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
71043828 | RefSeq | NP_001020919 | 262 | tafazzin |
Identical Sequences to LMP013508 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:71043828 | GenBank | AAH99221.1 | 262 | Tafazzin [Rattus norvegicus] |
GI:71043828 | GenBank | EDL84983.1 | 262 | tafazzin (cardiomyopathy, dilated 3A (X-linked); endocardial fibroelastosis 2; Barth syndrome) (mapped), isoform CRA_c [Rattus norvegicus] |
GI:71043828 | RefSeq | XP_006229661.1 | 262 | PREDICTED: tafazzin isoform X1 [Rattus norvegicus] |
GI:71043828 | RefSeq | XP_006229662.1 | 262 | PREDICTED: tafazzin isoform X1 [Rattus norvegicus] |
Related Sequences to LMP013508 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:71043828 | GenBank | AAH99221.1 | 262 | Tafazzin [Rattus norvegicus] |
GI:71043828 | GenBank | EDL84983.1 | 262 | tafazzin (cardiomyopathy, dilated 3A (X-linked); endocardial fibroelastosis 2; Barth syndrome) (mapped), isoform CRA_c [Rattus norvegicus] |
GI:71043828 | RefSeq | XP_006229661.1 | 262 | PREDICTED: tafazzin isoform X1 [Rattus norvegicus] |
GI:71043828 | RefSeq | XP_006229662.1 | 262 | PREDICTED: tafazzin isoform X1 [Rattus norvegicus] |