Gene/Proteome Database (LMPD)

LMPD ID
LMP013511
Gene ID
363989
Species
Rattus norvegicus (Rat)
Gene Name
pleckstrin homology-like domain, family A, member 3
Gene Symbol
Phlda3
Alternate Names
pleckstrin homology-like domain family A member 3; TDAG51/Ipl homolog 1;
Chromosome
13
Map Location
13q13

Proteins

pleckstrin homology-like domain family A member 3
Refseq ID NP_001012206
Protein GI 58865988
UniProt ID Q5PQT7
mRNA ID NM_001012206
Length 125
MTAAATVLKEGVLEKRSGGLLQLWKRKRCVLTERGLQLFEAKGTGGRPKELSFSRIKAVECVESTGRHIYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSLGTGTLVS

Gene Information

Entrez Gene ID
363989
Gene Name
pleckstrin homology-like domain, family A, member 3
Gene Symbol
Phlda3
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0005886 ISS:UniProtKB C plasma membrane
GO:0005547 ISS:UniProtKB F phosphatidylinositol-3,4,5-trisphosphate binding
GO:0043325 ISS:UniProtKB F phosphatidylinositol-3,4-bisphosphate binding
GO:0080025 ISS:UniProtKB F phosphatidylinositol-3,5-bisphosphate binding
GO:0032266 ISS:UniProtKB F phosphatidylinositol-3-phosphate binding
GO:0005546 ISS:UniProtKB F phosphatidylinositol-4,5-bisphosphate binding
GO:0010314 ISS:UniProtKB F phosphatidylinositol-5-phosphate binding
GO:0042771 ISS:UniProtKB P intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0051898 ISS:UniProtKB P negative regulation of protein kinase B signaling
GO:0043065 ISS:UniProtKB P positive regulation of apoptotic process

Domain Information

InterPro Annotations

Accession Description
IPR001849 Pleckstrin homology domain
IPR011993 Pleckstrin homology-like domain

UniProt Annotations

Entry Information

Gene Name
pleckstrin homology-like domain, family A, member 3
Protein Entry
PHLA3_RAT
UniProt ID
Q5PQT7
Species
Rat

Comments

Comment Type Description
Domain The PH domain binds phosphoinositides with a broad specificity. It competes with the PH domain of AKT1 and directly interferes with AKT1 binding to phosphatidylinositol 4,5- bisphosphate (PIP2) and phosphatidylinositol 3,4,5-trisphosphate (PIP3), preventing AKT1 association to membrane lipids and subsequent activation of AKT1 signaling (By similarity)
Function p53/TP53-regulated repressor of Akt/AKT1 signaling. Represses AKT1 by preventing AKT1-binding to membrane lipids, thereby inhibiting AKT1 translocation to the cellular membrane and activation. Contributes to p53/TP53-dependent apoptosis by repressing AKT1 activity. Its direct transcription regulation by p53/TP53 may explain how p53/TP53 can negatively regulate AKT1. May act as a tumor suppressor (By similarity)
Similarity Belongs to the PHLDA3 family
Similarity Contains 1 PH domain
Subcellular Location Cytoplasm . Membrane {ECO:0000250}; Peripheral membrane protein .

Identical and Related Proteins

Unique RefSeq proteins for LMP013511 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
58865988 RefSeq NP_001012206 125 pleckstrin homology-like domain family A member 3

Identical Sequences to LMP013511 proteins

Reference Database Accession Length Protein Name
GI:58865988 GenBank AAH87038.1 125 Pleckstrin homology-like domain, family A, member 3 [Rattus norvegicus]
GI:58865988 GenBank EDM09684.1 125 rCG46130 [Rattus norvegicus]
GI:58865988 SwissProt Q5PQT7.1 125 RecName: Full=Pleckstrin homology-like domain family A member 3; AltName: Full=TDAG51/Ipl homolog 1 [Rattus norvegicus]

Related Sequences to LMP013511 proteins

Reference Database Accession Length Protein Name
GI:58865988 GenBank AAH87038.1 125 Pleckstrin homology-like domain, family A, member 3 [Rattus norvegicus]
GI:58865988 GenBank EDM09684.1 125 rCG46130 [Rattus norvegicus]
GI:58865988 RefSeq XP_005348463.1 125 PREDICTED: pleckstrin homology-like domain family A member 3 [Microtus ochrogaster]
GI:58865988 SwissProt Q5PQT7.1 125 RecName: Full=Pleckstrin homology-like domain family A member 3; AltName: Full=TDAG51/Ipl homolog 1 [Rattus norvegicus]