Gene/Proteome Database (LMPD)

LMPD ID
LMP013560
Gene ID
497009
Species
Rattus norvegicus (Rat)
Gene Name
N-acylethanolamine acid amidase
Gene Symbol
Naaa
Synonyms
Asahl;
Alternate Names
N-acylethanolamine-hydrolyzing acid amidase; ASAH-like protein;
Chromosome
14
Map Location
14p22
EC Number
3.5.1.-

Proteins

N-acylethanolamine-hydrolyzing acid amidase precursor
Refseq ID NP_001010967
Protein GI 58219537
UniProt ID Q5KTC7
mRNA ID NM_001010967
Length 362
MGTPAIRAACHGAHLALALLLLLSLSDPWLWATAPGTPPLFNVSLDAAPELRWLPMLQHYDPDFVRAAVAQVIGDRVPQWILEMIGEIVQKVESFLPQPFTSEIRGICDYLNLSLAEGVLVNLAYEASAFCTSIVAQDSQGRIYHGRNLDYPFGNALRKLTADVQFVKNGQIVFTATTFVGYVGLWTGQSPHKFTISGDERDKGWWWENMIAALSLGHSPISWLIRKTLTESEDFEAAVYTLAKTPLIADVYYIVGGTSPQEGVVITRDRGGPADIWPLDPLNGAWFRVETNYDHWEPVPKRDDRRTPAIKALNATGQAHLSLETLFQVLSVFPVYNNYTIYTTVMSAAEPDKYMTMIRNPS
sig_peptide: 1..33 inference: non-experimental evidence, no additional details recorded note: By similarity; propagated from UniProtKB/Swiss-Prot (Q5KTC7.1) calculated_mol_wt: 3484 peptide sequence: MGTPAIRAACHGAHLALALLLLLSLSDPWLWAT mat_peptide: 34..362 product: N-acylethanolamine-hydrolyzing acid amidase experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q5KTC7.1) calculated_mol_wt: 36847 peptide sequence: APGTPPLFNVSLDAAPELRWLPMLQHYDPDFVRAAVAQVIGDRVPQWILEMIGEIVQKVESFLPQPFTSEIRGICDYLNLSLAEGVLVNLAYEASAFCTSIVAQDSQGRIYHGRNLDYPFGNALRKLTADVQFVKNGQIVFTATTFVGYVGLWTGQSPHKFTISGDERDKGWWWENMIAALSLGHSPISWLIRKTLTESEDFEAAVYTLAKTPLIADVYYIVGGTSPQEGVVITRDRGGPADIWPLDPLNGAWFRVETNYDHWEPVPKRDDRRTPAIKALNATGQAHLSLETLFQVLSVFPVYNNYTIYTTVMSAAEPDKYMTMIRNPS

Gene Information

Entrez Gene ID
497009
Gene Name
N-acylethanolamine acid amidase
Gene Symbol
Naaa
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0005764 IEA:UniProtKB-KW C lysosome
GO:0016810 IEA:Ensembl F hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
GO:0006629 IEA:InterPro P lipid metabolic process

Domain Information

InterPro Annotations

Accession Description
IPR029130 Acid ceramidase, N-terminal
IPR016699 Acid_ceramidase-like
IPR029132 Choloylglycine hydrolase/NAAA C-terminal

UniProt Annotations

Entry Information

Gene Name
N-acylethanolamine acid amidase
Protein Entry
NAAA_RAT
UniProt ID
Q5KTC7
Species
Rat

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=35 uM for N-palmitoylethanolamine ; pH dependence: Optimum pH is 5 with N-palmitoylethanolamine as substrate. ;
Enzyme Regulation Stimulated by DTT and Triton X-100
Function Degrades bioactive fatty acid amides to their corresponding acids, with the following preference: N- palmitoylethanolamine > N-myristoylethanolamine > N- stearoylethanolamine > N-oleoylethanolamine > N- linoleoylethanolamine > N-arachidonoylethanolamine
Ptm Autoproteolytic cleavage in the acidic lumen of the lysosome activates the enzyme
Similarity Belongs to the acid ceramidase family
Subcellular Location Lysosome .
Subunit Heterodimer of an alpha and a beta subunit, non- covalently linked
Tissue Specificity Expressed in brain, cecum, colon, heart, ileum, kidney, liver, lung, spleen, stomach, submaxillary gland, testis and thymus

Identical and Related Proteins

Unique RefSeq proteins for LMP013560 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
58219537 RefSeq NP_001010967 362 N-acylethanolamine-hydrolyzing acid amidase precursor

Identical Sequences to LMP013560 proteins

Reference Database Accession Length Protein Name
GI:58219537 DBBJ BAD88529.1 362 N-acylethanolamine-hydrolyzing acid amidase [Rattus norvegicus]
GI:58219537 GenBank AAI05772.1 362 N-acylethanolamine acid amidase [Rattus norvegicus]
GI:58219537 GenBank EDL88613.1 362 N-acylsphingosine amidohydrolase (acid ceramidase)-like (predicted), isoform CRA_c [Rattus norvegicus]
GI:58219537 SwissProt Q5KTC7.1 362 RecName: Full=N-acylethanolamine-hydrolyzing acid amidase; AltName: Full=N-acylsphingosine amidohydrolase-like; Short=ASAH-like protein; Contains: RecName: Full=N-acylethanolamine-hydrolyzing acid amidase subunit alpha; Contains: RecName: Full=N-acylethanolamine-hydrolyzing acid amidase subunit beta; Flags: Precursor [Rattus norvegicus]

Related Sequences to LMP013560 proteins

Reference Database Accession Length Protein Name
GI:58219537 DBBJ BAD88529.1 362 N-acylethanolamine-hydrolyzing acid amidase [Rattus norvegicus]
GI:58219537 GenBank AAI05772.1 362 N-acylethanolamine acid amidase [Rattus norvegicus]
GI:58219537 GenBank EDL88613.1 362 N-acylsphingosine amidohydrolase (acid ceramidase)-like (predicted), isoform CRA_c [Rattus norvegicus]
GI:58219537 SwissProt Q5KTC7.1 362 RecName: Full=N-acylethanolamine-hydrolyzing acid amidase; AltName: Full=N-acylsphingosine amidohydrolase-like; Short=ASAH-like protein; Contains: RecName: Full=N-acylethanolamine-hydrolyzing acid amidase subunit alpha; Contains: RecName: Full=N-acylethanolamine-hydrolyzing acid amidase subunit beta; Flags: Precursor [Rattus norvegicus]