Gene/Proteome Database (LMPD)
Proteins
glycolipid transfer protein domain-containing protein 2 | |
---|---|
Refseq ID | NP_001108502 |
Protein GI | 198041781 |
UniProt ID | B0BNN1 |
mRNA ID | NM_001115030 |
Length | 329 |
MVLGVSLSPALGRWFRHAIPFAIFTLLLLYISVWLFHEWPFELPAQRTQQSGLWELKLSSPSPALTSLLPVTSGVLPGCRPGVQSCNPERALPSQIGPALRPLVVPEKEEPPCLRPHGLLGRMVSPFLACMSPEGDVELSQYLAGWRELLRLLTPLGSVFAFATSEASNKVTALEAHVHGPDASYYTSLVTMATWERRAVLLERPGTTPRHLARPSGSQTLLLLHRALRWSQLCLHRVATGKLGGPEAGAQCRDAYSTALAPYHPWLIRQAARLAILTLPSRSRLLQLACPGTGEADARVALARAARVLEDVYNRTQGLLASHGLLQLA |
Gene Information
Entrez Gene ID
Gene Name
glycolipid transfer protein domain containing 2
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005737 | IEA:InterPro | C | cytoplasm |
GO:0051861 | IEA:InterPro | F | glycolipid binding |
GO:0017089 | IEA:InterPro | F | glycolipid transporter activity |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR014830 | Glycolipid transfer protein domain |
UniProt Annotations
Entry Information
Gene Name
glycolipid transfer protein domain containing 2
Protein Entry
B0BNN1_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP013566 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
198041781 | RefSeq | NP_001108502 | 329 | glycolipid transfer protein domain-containing protein 2 |
Identical Sequences to LMP013566 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:198041781 | GenBank | AAI58887.1 | 329 | Gltpd2 protein [Rattus norvegicus] |
Related Sequences to LMP013566 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:198041781 | GenBank | AAH30735.1 | 321 | Glycolipid transfer protein domain containing 2 [Mus musculus] |
GI:198041781 | GenBank | EDL12575.1 | 321 | RIKEN cDNA C730027E14, isoform CRA_b [Mus musculus] |
GI:198041781 | GenBank | AAI58887.1 | 329 | Gltpd2 protein [Rattus norvegicus] |
GI:198041781 | RefSeq | NP_666132.1 | 321 | glycolipid transfer protein domain-containing protein 2 [Mus musculus] |