Gene/Proteome Database (LMPD)

LMPD ID
LMP013570
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
coenzyme Q2 4-hydroxybenzoate polyprenyltransferase
Gene Symbol
Synonyms
RGD1306722;
Alternate Names
4-hydroxybenzoate polyprenyltransferase, mitochondrial; PHB:polyprenyltransferase; coenzyme Q2 homolog, prenyltransferase; para-hydroxybenzoate--polyprenyltransferase, mitochondrial;
Chromosome
14
Map Location
14p22
EC Number
2.5.1.39

Proteins

4-hydroxybenzoate polyprenyltransferase, mitochondrial precursor
Refseq ID NP_001037720
Protein GI 112984196
UniProt ID Q499N4
mRNA ID NM_001044255
Length 374
MLRLGGAGLVRGLRVVSPAWLRGPGGLPLALARTTGTSGARDRRAPASGTQRGRALSLSAAAVVNSAPRPLQPYLRLMRLDKPIGTWLLYLPCTWSIGLAADPGCFPDWYMLSLFGTGAILMRGAGCTINDMWDRDFDKKVERTANRPIAAGDISAFQSFVFLGAQLTLALGVLLHLNYYSIAMGAASLLLVVTYPLMKRVTFWPQLALGLTFNWGALLGWSAVKGSCDPAVCLPLYFSGVMWTLIYDTIYAHQDKKDDALIGLKSTALLFRENTKQWLSGFGVAMVGALSLVGASSGQTLPYYAAVAAVGAHLAHQIYTVDIHRAEDCWEKFTSNRTVGLLLFLGIVLGNLYKDKPDETKGVDAVGEESERTS
transit_peptide: 1..63 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (Potential); propagated from UniProtKB/Swiss-Prot (Q499N4.1) calculated_mol_wt: 6306 peptide sequence: MLRLGGAGLVRGLRVVSPAWLRGPGGLPLALARTTGTSGARDRRAPASGTQRGRALSLSAAAV mat_peptide: 64..374 product: 4-hydroxybenzoate polyprenyltransferase, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q499N4.1) calculated_mol_wt: 34118 peptide sequence: VNSAPRPLQPYLRLMRLDKPIGTWLLYLPCTWSIGLAADPGCFPDWYMLSLFGTGAILMRGAGCTINDMWDRDFDKKVERTANRPIAAGDISAFQSFVFLGAQLTLALGVLLHLNYYSIAMGAASLLLVVTYPLMKRVTFWPQLALGLTFNWGALLGWSAVKGSCDPAVCLPLYFSGVMWTLIYDTIYAHQDKKDDALIGLKSTALLFRENTKQWLSGFGVAMVGALSLVGASSGQTLPYYAAVAAVGAHLAHQIYTVDIHRAEDCWEKFTSNRTVGLLLFLGIVLGNLYKDKPDETKGVDAVGEESERTS

Gene Information

Entrez Gene ID
Gene Name
coenzyme Q2 4-hydroxybenzoate polyprenyltransferase
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005739 IEA:UniProtKB-KW C mitochondrion
GO:0002083 IEA:UniProtKB-EC F 4-hydroxybenzoate decaprenyltransferase activity
GO:0047293 IEA:UniProtKB-EC F 4-hydroxybenzoate nonaprenyltransferase activity
GO:0008299 IEA:UniProtKB-KW P isoprenoid biosynthetic process
GO:0006744 IEA:UniProtKB-UniPathway P ubiquinone biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
rno01100 Metabolic pathways
ko00130 Ubiquinone and other terpenoid-quinone biosynthesis
rno00130 Ubiquinone and other terpenoid-quinone biosynthesis
M00128 Ubiquinone biosynthesis, eukaryotes, 4-hydroxybenzoate => ubiquinone

Domain Information

InterPro Annotations

Accession Description
IPR006370 4-hydroxybenzoate polyprenyl transferase
IPR000537 UbiA prenyltransferase family

UniProt Annotations

Entry Information

Gene Name
coenzyme Q2 4-hydroxybenzoate polyprenyltransferase
Protein Entry
COQ2_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity A polyprenyl diphosphate + 4-hydroxybenzoate = diphosphate + a 4-hydroxy-3-polyprenylbenzoate.
Function Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. Mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB (By similarity)
Pathway Cofactor biosynthesis; ubiquinone biosynthesis.
Similarity Belongs to the UbiA prenyltransferase family
Subcellular Location Mitochondrion membrane ; Multi- pass membrane protein .

Identical and Related Proteins

Unique RefSeq proteins for LMP013570 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
112984196 RefSeq NP_001037720 374 4-hydroxybenzoate polyprenyltransferase, mitochondrial precursor

Identical Sequences to LMP013570 proteins

Reference Database Accession Length Protein Name
GI:112984196 GenBank AAH99827.1 374 Coenzyme Q2 homolog, prenyltransferase (yeast) [Rattus norvegicus]
GI:112984196 SwissProt Q499N4.1 374 RecName: Full=4-hydroxybenzoate polyprenyltransferase, mitochondrial; AltName: Full=Para-hydroxybenzoate--polyprenyltransferase; Short=PHB:polyprenyltransferase; Flags: Precursor [Rattus norvegicus]

Related Sequences to LMP013570 proteins

Reference Database Accession Length Protein Name
GI:112984196 GenBank AAH80773.1 374 Coenzyme Q2 homolog, prenyltransferase (yeast) [Mus musculus]
GI:112984196 GenBank AAH99827.1 374 Coenzyme Q2 homolog, prenyltransferase (yeast) [Rattus norvegicus]
GI:112984196 GenBank EDL99561.1 374 similar to 2310002F18Rik protein, isoform CRA_c [Rattus norvegicus]
GI:112984196 SwissProt Q499N4.1 374 RecName: Full=4-hydroxybenzoate polyprenyltransferase, mitochondrial; AltName: Full=Para-hydroxybenzoate--polyprenyltransferase; Short=PHB:polyprenyltransferase; Flags: Precursor [Rattus norvegicus]