Gene/Proteome Database (LMPD)
LMPD ID
LMP013570
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
coenzyme Q2 4-hydroxybenzoate polyprenyltransferase
Gene Symbol
Synonyms
RGD1306722;
Alternate Names
4-hydroxybenzoate polyprenyltransferase, mitochondrial; PHB:polyprenyltransferase; coenzyme Q2 homolog, prenyltransferase; para-hydroxybenzoate--polyprenyltransferase, mitochondrial;
Chromosome
14
Map Location
14p22
EC Number
2.5.1.39
Proteins
| 4-hydroxybenzoate polyprenyltransferase, mitochondrial precursor | |
|---|---|
| Refseq ID | NP_001037720 |
| Protein GI | 112984196 |
| UniProt ID | Q499N4 |
| mRNA ID | NM_001044255 |
| Length | 374 |
| MLRLGGAGLVRGLRVVSPAWLRGPGGLPLALARTTGTSGARDRRAPASGTQRGRALSLSAAAVVNSAPRPLQPYLRLMRLDKPIGTWLLYLPCTWSIGLAADPGCFPDWYMLSLFGTGAILMRGAGCTINDMWDRDFDKKVERTANRPIAAGDISAFQSFVFLGAQLTLALGVLLHLNYYSIAMGAASLLLVVTYPLMKRVTFWPQLALGLTFNWGALLGWSAVKGSCDPAVCLPLYFSGVMWTLIYDTIYAHQDKKDDALIGLKSTALLFRENTKQWLSGFGVAMVGALSLVGASSGQTLPYYAAVAAVGAHLAHQIYTVDIHRAEDCWEKFTSNRTVGLLLFLGIVLGNLYKDKPDETKGVDAVGEESERTS | |
| transit_peptide: 1..63 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (Potential); propagated from UniProtKB/Swiss-Prot (Q499N4.1) calculated_mol_wt: 6306 peptide sequence: MLRLGGAGLVRGLRVVSPAWLRGPGGLPLALARTTGTSGARDRRAPASGTQRGRALSLSAAAV mat_peptide: 64..374 product: 4-hydroxybenzoate polyprenyltransferase, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q499N4.1) calculated_mol_wt: 34118 peptide sequence: VNSAPRPLQPYLRLMRLDKPIGTWLLYLPCTWSIGLAADPGCFPDWYMLSLFGTGAILMRGAGCTINDMWDRDFDKKVERTANRPIAAGDISAFQSFVFLGAQLTLALGVLLHLNYYSIAMGAASLLLVVTYPLMKRVTFWPQLALGLTFNWGALLGWSAVKGSCDPAVCLPLYFSGVMWTLIYDTIYAHQDKKDDALIGLKSTALLFRENTKQWLSGFGVAMVGALSLVGASSGQTLPYYAAVAAVGAHLAHQIYTVDIHRAEDCWEKFTSNRTVGLLLFLGIVLGNLYKDKPDETKGVDAVGEESERTS | |
Gene Information
Entrez Gene ID
Gene Name
coenzyme Q2 4-hydroxybenzoate polyprenyltransferase
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005739 | IEA:UniProtKB-KW | C | mitochondrion |
| GO:0002083 | IEA:UniProtKB-EC | F | 4-hydroxybenzoate decaprenyltransferase activity |
| GO:0047293 | IEA:UniProtKB-EC | F | 4-hydroxybenzoate nonaprenyltransferase activity |
| GO:0008299 | IEA:UniProtKB-KW | P | isoprenoid biosynthetic process |
| GO:0006744 | IEA:UniProtKB-UniPathway | P | ubiquinone biosynthetic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
coenzyme Q2 4-hydroxybenzoate polyprenyltransferase
Protein Entry
COQ2_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | A polyprenyl diphosphate + 4-hydroxybenzoate = diphosphate + a 4-hydroxy-3-polyprenylbenzoate. |
| Function | Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. Mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB (By similarity) |
| Pathway | Cofactor biosynthesis; ubiquinone biosynthesis. |
| Similarity | Belongs to the UbiA prenyltransferase family |
| Subcellular Location | Mitochondrion membrane ; Multi- pass membrane protein . |
Identical and Related Proteins
Unique RefSeq proteins for LMP013570 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 112984196 | RefSeq | NP_001037720 | 374 | 4-hydroxybenzoate polyprenyltransferase, mitochondrial precursor |
Identical Sequences to LMP013570 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:112984196 | GenBank | AAH99827.1 | 374 | Coenzyme Q2 homolog, prenyltransferase (yeast) [Rattus norvegicus] |
| GI:112984196 | SwissProt | Q499N4.1 | 374 | RecName: Full=4-hydroxybenzoate polyprenyltransferase, mitochondrial; AltName: Full=Para-hydroxybenzoate--polyprenyltransferase; Short=PHB:polyprenyltransferase; Flags: Precursor [Rattus norvegicus] |
Related Sequences to LMP013570 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:112984196 | GenBank | AAH80773.1 | 374 | Coenzyme Q2 homolog, prenyltransferase (yeast) [Mus musculus] |
| GI:112984196 | GenBank | AAH99827.1 | 374 | Coenzyme Q2 homolog, prenyltransferase (yeast) [Rattus norvegicus] |
| GI:112984196 | GenBank | EDL99561.1 | 374 | similar to 2310002F18Rik protein, isoform CRA_c [Rattus norvegicus] |
| GI:112984196 | SwissProt | Q499N4.1 | 374 | RecName: Full=4-hydroxybenzoate polyprenyltransferase, mitochondrial; AltName: Full=Para-hydroxybenzoate--polyprenyltransferase; Short=PHB:polyprenyltransferase; Flags: Precursor [Rattus norvegicus] |