Gene/Proteome Database (LMPD)
Proteins
| ubiquinone biosynthesis protein COQ9, mitochondrial precursor | |
|---|---|
| Refseq ID | NP_001030334 |
| Protein GI | 78214350 |
| UniProt ID | Q68FT1 |
| mRNA ID | NM_001035257 |
| Length | 312 |
| MAATAAVSGVLRRLGWRLLQLRCLPVARCQSPLMPRAFHTAVGFRSSEEQRQQPPHSSQQHSETQGPEFSRPPPRYTDQSGEEEEDYESEEQIQHRILTAALEFVPDHGWTAEAIAEGAQSLGLSSAAASMFGSDGSELILHFVTQCNARLNHVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILLLPQNIPPSLSLLTSMVDDMWHYAGDQSTDFNWYTRRAVLAGIYNTTELVMMQDSSPDFEDTWRFLDNRINDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRR | |
| transit_peptide: 1..45 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (Potential); propagated from UniProtKB/Swiss-Prot (Q68FT1.2) calculated_mol_wt: 4979 peptide sequence: MAATAAVSGVLRRLGWRLLQLRCLPVARCQSPLMPRAFHTAVGFR mat_peptide: 46..312 product: Ubiquinone biosynthesis protein COQ9, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q68FT1.2) calculated_mol_wt: 30185 peptide sequence: SSEEQRQQPPHSSQQHSETQGPEFSRPPPRYTDQSGEEEEDYESEEQIQHRILTAALEFVPDHGWTAEAIAEGAQSLGLSSAAASMFGSDGSELILHFVTQCNARLNHVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILLLPQNIPPSLSLLTSMVDDMWHYAGDQSTDFNWYTRRAVLAGIYNTTELVMMQDSSPDFEDTWRFLDNRINDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRR | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005739 | IEA:UniProtKB-KW | C | mitochondrion |
| GO:0006120 | IEA:Ensembl | P | mitochondrial electron transport, NADH to ubiquinone |
| GO:0006744 | IEA:UniProtKB-UniPathway | P | ubiquinone biosynthetic process |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Involved in the biosynthesis of coenzyme Q |
| Pathway | Cofactor biosynthesis; ubiquinone biosynthesis. |
| Similarity | Belongs to the COQ9 family |
| Subcellular Location | Mitochondrion . |
Identical and Related Proteins
Unique RefSeq proteins for LMP013578 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 78214350 | RefSeq | NP_001030334 | 312 | ubiquinone biosynthesis protein COQ9, mitochondrial precursor |
Identical Sequences to LMP013578 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:78214350 | GenBank | AAI27450.1 | 312 | Coenzyme Q9 homolog (S. cerevisiae) [Rattus norvegicus] |
| GI:78214350 | SwissProt | Q68FT1.2 | 312 | RecName: Full=Ubiquinone biosynthesis protein COQ9, mitochondrial; Flags: Precursor [Rattus norvegicus] |
Related Sequences to LMP013578 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:78214350 | GenBank | AAH79370.1 | 310 | Coq9 protein, partial [Rattus norvegicus] |
| GI:78214350 | GenBank | AAI04703.1 | 310 | Coq9 protein, partial [Rattus norvegicus] |
| GI:78214350 | GenBank | AAI27450.1 | 312 | Coenzyme Q9 homolog (S. cerevisiae) [Rattus norvegicus] |
| GI:78214350 | SwissProt | Q68FT1.2 | 312 | RecName: Full=Ubiquinone biosynthesis protein COQ9, mitochondrial; Flags: Precursor [Rattus norvegicus] |